DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp1 and Foxd4

DIOPT Version :9

Sequence 1:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster
Sequence 2:XP_001055972.2 Gene:Foxd4 / 252886 RGDID:621716 Length:432 Species:Rattus norvegicus


Alignment Length:276 Identity:93/276 - (33%)
Similarity:115/276 - (41%) Gaps:83/276 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 STPMSSAAESLSSQNNDKLDVEFDDELEDQLDEDQESEDGN------------------------ 105
            |||..|...|      |..:||. |.|.::.|.||..:||.                        
  Rat    11 STPPPSPLSS------DPEEVEI-DVLAEEEDGDQTEDDGGEESHKCLERSLQRPGARTLARRSA 68

  Fly   106 ------------------PSKKQKMTA--GSDTKKPPYSYNALIMMAIQDSPEQRLTLNGIYQYL 150
                              |..:...|.  |....||||||.|||.|||..||.:||||:||..::
  Rat    69 WDCGDLSNSSGFLRKFRAPRTRATTTTADGPQPAKPPYSYIALITMAILQSPHKRLTLSGICAFI 133

  Fly   151 INRFPYFKANKRGWQNSIRHNLSLNKCFTKIPRSYDDPGKGNYWILDPSAEEVFIGETTGKLRRK 215
            ..||||::.....||||||||||||.||.||||....|||||||.|||:::::|  :....||| 
  Rat   134 SGRFPYYRRKFPAWQNSIRHNLSLNDCFVKIPREPGHPGKGNYWSLDPASQDMF--DNGSFLRR- 195

  Fly   216 NPGASRTRLAAYRQAIFSPMMAASPYGAPASSYGYPAVPFAAAAAAALYQRMNPAAYQAAYQQMQ 280
                 |.|...:.          .|.|      |:|..||...|..|..|...|...      ::
  Rat   196 -----RKRFKRHH----------PPPG------GHPHCPFPPPAVPATVQVSQPGLL------LR 233

  Fly   281 YQQAPQAHHHQAPHPA 296
            |...||.  :.|.|||
  Rat   234 YSAPPQP--NLAVHPA 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp1NP_476730.1 FH 120..205 CDD:214627 52/84 (62%)
Foxd4XP_001055972.2 Forkhead 103..189 CDD:278670 53/87 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.