DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp1 and Foxa1

DIOPT Version :9

Sequence 1:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster
Sequence 2:XP_038967720.1 Gene:Foxa1 / 25098 RGDID:2807 Length:475 Species:Rattus norvegicus


Alignment Length:248 Identity:87/248 - (35%)
Similarity:117/248 - (47%) Gaps:55/248 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 PSK--KQKMTAGSDTK---------KPPYSYNALIMMAIQDSPEQRLTLNGIYQYLINRFPYFKA 159
            ||.  :.:...|.|.|         ||||||.:||.||||.:|.:.|||:.|||::::.|||::.
  Rat   145 PSNLGRSRAGGGGDAKTFKRSYPHAKPPYSYISLITMAIQQAPSKMLTLSEIYQWIMDLFPYYRQ 209

  Fly   160 NKRGWQNSIRHNLSLNKCFTKIPRSYDDPGKGNYWILDPSAEEVFIGETTGKLRR-------KNP 217
            |::.|||||||:||.|.||.|:.||.|.||||:||.|.|.:..:|  |....|||       |.|
  Rat   210 NQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSYWTLHPDSGNMF--ENGCYLRRQKRFKCEKQP 272

  Fly   218 GA-------SRTRLAAYRQAIFSPM--MAASPY------------GAPASSYGYPAVP-----FA 256
            ||       ....:...|:....|:  .|.||.            ||||.  |..|.|     ..
  Rat   273 GAGGGSGGGGSKGVPENRKDPSGPVNPSAESPIHRGVHGKASQLEGAPAP--GPAASPQTLDHSG 335

  Fly   257 AAAAAALYQRMNPAAYQA---AYQQMQYQQAPQAH--HHQAPHPAQ--MQGYP 302
            |.|.....:..:||:..|   :.........|.:|  |..|||.:|  ::|.|
  Rat   336 ATATGGASELKSPASSSAPPISSGPGALASVPPSHPAHGLAPHESQLHLKGDP 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp1NP_476730.1 FH 120..205 CDD:214627 47/84 (56%)
Foxa1XP_038967720.1 Forkhead_N 17..169 CDD:369872 5/23 (22%)
FH_FOXA1 157..268 CDD:410812 54/112 (48%)
HNF_C 394..457 CDD:401339
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.