DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp1 and Foxi3

DIOPT Version :9

Sequence 1:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001094934.1 Gene:Foxi3 / 232077 MGIID:3511278 Length:399 Species:Mus musculus


Alignment Length:230 Identity:82/230 - (35%)
Similarity:112/230 - (48%) Gaps:59/230 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 ASEDFDSPSRT--STPMSSAAES----LSSQNNDKLDVEFDDELEDQLDEDQESEDGNPSKKQKM 112
            |...|..||.:  ::|..|||..    ||..:.:.|                          .||
Mouse    89 AQRGFAQPSASAPASPAGSAAPGELGWLSMASREDL--------------------------MKM 127

  Fly   113 TAGSDTKKPPYSYNALIMMAIQDSPEQRLTLNGIYQYLINRFPYFKANKRGWQNSIRHNLSLNKC 177
            .      :|||||:|||.||||.:||::|||:.|||::.:.||:::.:|.|||||||||||||.|
Mouse   128 V------RPPYSYSALIAMAIQSAPERKLTLSHIYQFVADNFPFYQRSKAGWQNSIRHNLSLNDC 186

  Fly   178 FTKIPRSYDDPGKGNYWILDPSAEEVFIGETTGKLRRKN-------------PGASRTRLAAYRQ 229
            |.|:||..|||||||||.|||:.|::|   ..|..|||.             .|.|::...:.|.
Mouse   187 FKKVPRDEDDPGKGNYWTLDPNCEKMF---DNGNFRRKRRRRAEASSNLTVPSGTSKSEGQSSRL 248

  Fly   230 AIFSPMMAASPYG--APASSYGYPAVPFAAAAAAA 262
            .:...:...||..  .|:.|   |..|....:.|:
Mouse   249 RVSGKLEGDSPSSILRPSQS---PEPPEGTKSTAS 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp1NP_476730.1 FH 120..205 CDD:214627 54/84 (64%)
Foxi3NP_001094934.1 Forkhead 129..215 CDD:278670 55/88 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.