DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp1 and Foxj3

DIOPT Version :9

Sequence 1:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001344106.1 Gene:Foxj3 / 230700 MGIID:2443432 Length:623 Species:Mus musculus


Alignment Length:224 Identity:78/224 - (34%)
Similarity:108/224 - (48%) Gaps:58/224 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 PSRTSTPMSSAAE-SLSS-------------QNND-----------KLDVEFDDELEDQLDEDQE 100
            ||.||..|:|..| ||:|             |.:|           |.:...|.......:|.|:
Mouse     9 PSVTSLRMTSELESSLTSMDWLPQLTMRAAIQKSDATQNAHGTGISKKNALLDPNTTLDQEEVQQ 73

  Fly   101 SEDGNPSKKQKMTAGSDTKKPPYSYNALIMMAIQDSPEQRLTLNGIYQYLINRFPYFKANKRGWQ 165
            .:||               ||||||.:||..||..||::::||:.|||::.:.|||::....||:
Mouse    74 HKDG---------------KPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYREAGSGWK 123

  Fly   166 NSIRHNLSLNKCFTKIPRSYDDPGKGNYWILDPSAEEVFIGETTGKLRRKNPGASRTRLAAYRQA 230
            |||||||||||||.|:|||.||||||:||.:|.:.:     |.|...|.|....|..|       
Mouse   124 NSIRHNLSLNKCFLKVPRSKDDPGKGSYWAIDTNPK-----EDTLPTRPKKRARSVER------- 176

  Fly   231 IFSPMMAASPYGAPASSYGYPAVPFAAAA 259
                  |::||...:.|.|...:...:|:
Mouse   177 ------ASTPYSIDSDSLGMECIISGSAS 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp1NP_476730.1 FH 120..205 CDD:214627 48/84 (57%)
Foxj3NP_001344106.1 COG5025 <54..347 CDD:227358 66/179 (37%)
Forkhead 78..155 CDD:365978 47/76 (62%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 143..178 15/52 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 248..275
PAT1 <311..>434 CDD:370676
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 316..451
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.