DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp1 and FOXS1

DIOPT Version :9

Sequence 1:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_004109.1 Gene:FOXS1 / 2307 HGNCID:3735 Length:330 Species:Homo sapiens


Alignment Length:178 Identity:74/178 - (41%)
Similarity:94/178 - (52%) Gaps:41/178 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 SDTKKPPYSYNALIMMAIQDSPEQRLTLNGIYQYLINRFPYFKANKRGWQNSIRHNLSLNKCFTK 180
            ::..||||||.|||.||||.||.||.||:|||:|::.||.:::.|:.|||||||||||||:||.|
Human    14 TEPTKPPYSYIALIAMAIQSSPGQRATLSGIYRYIMGRFAFYRHNRPGWQNSIRHNLSLNECFVK 78

  Fly   181 IPRSYDDPGKGNYWILDPSAEEVFIGETTGKLRR-----KNPGASRTRLAAY------------- 227
            :||....||||:||.|||...::|  |....|||     :..||..||..|.             
Human    79 VPRDDRKPGKGSYWTLDPDCHDMF--EHGSFLRRRRRFTRQTGAEGTRGPAKARRGPLRATSQDP 141

  Fly   228 --------RQAIFSP------------MMAASPYG-APASSYGYPAVP 254
                    ||..|.|            ::.|.|.. .||::.|.|..|
Human   142 GVPNATTGRQCSFPPELPDPKGLSFGGLVGAMPASMCPATTDGRPRPP 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp1NP_476730.1 FH 120..205 CDD:214627 53/84 (63%)
FOXS1NP_004109.1 Forkhead 18..103 CDD:306709 54/86 (63%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 111..157 8/45 (18%)
DNA_pol3_gamma3 <116..313 CDD:331207 16/74 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 179..200 5/11 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.