Sequence 1: | NP_476730.1 | Gene: | slp1 / 33607 | FlyBaseID: | FBgn0003430 | Length: | 322 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_004465.3 | Gene: | FOXD2 / 2306 | HGNCID: | 3803 | Length: | 495 | Species: | Homo sapiens |
Alignment Length: | 302 | Identity: | 105/302 - (34%) |
---|---|---|---|
Similarity: | 130/302 - (43%) | Gaps: | 83/302 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 89 DELEDQLDEDQES----EDGNP----SKKQKMTAGSD-----------------------TK--- 119
Fly 120 -KPPYSYNALIMMAIQDSPEQRLTLNGIYQYLINRFPYFKANKRGWQNSIRHNLSLNKCFTKIPR 183
Fly 184 SYDDPGKGNYWILDPSAEEVFIGETTGKLRRK-------------------------------NP 217
Fly 218 GASRTRLAAYRQAIFSPMMAASPYGAP---ASSYGYP---AVPFAAAAAAALYQRMNPAAYQAAY 276
Fly 277 QQMQYQQAPQAHHHQAPHPAQMQ---------GYPQQLNAEL 309 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
slp1 | NP_476730.1 | FH | 120..205 | CDD:214627 | 51/84 (61%) |
FOXD2 | NP_004465.3 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 14..122 | 13/60 (22%) | |
Forkhead | 127..213 | CDD:278670 | 52/87 (60%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 312..347 | 7/34 (21%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 397..444 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG2294 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1270467at2759 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0000010 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR11829 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
5 | 4.920 |