DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp1 and FOXM1

DIOPT Version :9

Sequence 1:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_973731.1 Gene:FOXM1 / 2305 HGNCID:3818 Length:801 Species:Homo sapiens


Alignment Length:245 Identity:71/245 - (28%)
Similarity:111/245 - (45%) Gaps:36/245 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 SDGELSASEDFDSPSRTSTPMSSAAESLSSQNNDKLDVEFDDELEDQLDEDQESEDGNPSKKQKM 112
            :|||.:.....:|.|........:::.|.|::   :..|.:::....|::.|...: .||:....
Human   168 ADGEAAGCTINNSLSNIQWLRKMSSDGLGSRS---IKQEMEEKENCHLEQRQVKVE-EPSRPSAS 228

  Fly   113 TAGSDTKKPPYSYNALIMMAIQDSPEQRLTLNGIYQYLINRFPYFK-ANKRGWQNSIRHNLSLNK 176
            ...|.:::|||||.|:|..||..:..:|:||..||.::.:.||||| ..|.||:|||||||||:.
Human   229 WQNSVSERPPYSYMAMIQFAINSTERKRMTLKDIYTWIEDHFPYFKHIAKPGWKNSIRHNLSLHD 293

  Fly   177 CFTKIPRSYDDPGKGNYWILDPSA------EEVFIGETTG----------KLRRKNPGASR---- 221
            .|.   |.....||.::|.:.|||      ::||.....|          :.:|.||...|    
Human   294 MFV---RETSANGKVSFWTIHPSANRYLTLDQVFKPLDPGSPQLPEHLESQQKRPNPELRRNMTI 355

  Fly   222 -TRLAAYRQAIFSPMM-AASPYGAP------ASSYGYPAVPFAAAAAAAL 263
             |.|....:....|:: ..|.|..|      .|....|:|......||:|
Human   356 KTELPLGARRKMKPLLPRVSSYLVPIQFPVNQSLVLQPSVKVPLPLAASL 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp1NP_476730.1 FH 120..205 CDD:214627 40/91 (44%)
FOXM1NP_973731.1 FH 236..311 CDD:238016 36/77 (47%)
Herpes_ICP4_C 504..>749 CDD:332854
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.