DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp1 and FOXE1

DIOPT Version :9

Sequence 1:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_004464.2 Gene:FOXE1 / 2304 HGNCID:3806 Length:373 Species:Homo sapiens


Alignment Length:228 Identity:90/228 - (39%)
Similarity:120/228 - (52%) Gaps:37/228 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 GNPSKKQKMTAGSDTKKPPYSYNALIMMAIQDSPEQRLTLNGIYQYLINRFPYFKANKRGWQNSI 168
            |...:|:.:..|    ||||||.|||.|||..:||:||||.|||:::..|||:::.|.:.|||||
Human    41 GGRRRKRPLQRG----KPPYSYIALIAMAIAHAPERRLTLGGIYKFITERFPFYRDNPKKWQNSI 101

  Fly   169 RHNLSLNKCFTKIPRSYDDPGKGNYWILDPSAEEVFIGETTGKLRRKNPGASRTRLAAYRQAIFS 233
            ||||:||.||.||||....|||||||.|||:||::|   .:|...|:.....|:.|:.|...:..
Human   102 RHNLTLNDCFLKIPREAGRPGKGNYWALDPNAEDMF---ESGSFLRRRKRFKRSDLSTYPAYMHD 163

  Fly   234 PMMAASPYGAPASSYGYPAVPFAAAAAAALYQRMNPA-------AYQAAYQQMQYQQAPQAHHHQ 291
            ...||             |...|||||||::....||       |..|.|........|..::..
Human   164 AAAAA-------------AAAAAAAAAAAIFPGAVPAARPPYPGAVYAGYAPPSLAAPPPVYYPA 215

  Fly   292 A-PHPAQMQG-YPQQ-LNAELFQRMQFFGKFPS 321
            | |.|.::.| .|:: |:.||       |..||
Human   216 ASPGPCRVFGLVPERPLSPEL-------GPAPS 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp1NP_476730.1 FH 120..205 CDD:214627 54/84 (64%)
FOXE1NP_004464.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 19..51 2/9 (22%)
FH 53..141 CDD:214627 55/90 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.