Sequence 1: | NP_476730.1 | Gene: | slp1 / 33607 | FlyBaseID: | FBgn0003430 | Length: | 322 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_005242.1 | Gene: | FOXC2 / 2303 | HGNCID: | 3801 | Length: | 501 | Species: | Homo sapiens |
Alignment Length: | 221 | Identity: | 87/221 - (39%) |
---|---|---|---|
Similarity: | 119/221 - (53%) | Gaps: | 45/221 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 106 PSKKQKMTAGSDTKKPPYSYNALIMMAIQDSPEQRLTLNGIYQYLINRFPYFKANKRGWQNSIRH 170
Fly 171 NLSLNKCFTKIPRSYDDPGKGNYWILDPSAEEVFIGETTGKLRR----KNPGASRTRLAAYRQAI 231
Fly 232 FSPMMAASPYGAPASSYGYPAVPFAA---------------AAAAAL-----YQRMNP-AAYQAA 275
Fly 276 YQQMQYQQA-------PQAHHHQAPH 294 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
slp1 | NP_476730.1 | FH | 120..205 | CDD:214627 | 54/84 (64%) |
FOXC2 | NP_005242.1 | FH | 72..160 | CDD:214627 | 56/89 (63%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 167..208 | 12/50 (24%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 232..268 | 9/35 (26%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 383..420 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1270467at2759 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0000010 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.920 |