DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp1 and FOXC2

DIOPT Version :9

Sequence 1:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_005242.1 Gene:FOXC2 / 2303 HGNCID:3801 Length:501 Species:Homo sapiens


Alignment Length:221 Identity:87/221 - (39%)
Similarity:119/221 - (53%) Gaps:45/221 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 PSKKQKMTAGSDTKKPPYSYNALIMMAIQDSPEQRLTLNGIYQYLINRFPYFKANKRGWQNSIRH 170
            |....:..|..|..||||||.|||.||||::||:::|||||||::::|||:::.||:||||||||
Human    58 PYHHHQPAAPKDLVKPPYSYIALITMAIQNAPEKKITLNGIYQFIMDRFPFYRENKQGWQNSIRH 122

  Fly   171 NLSLNKCFTKIPRSYDDPGKGNYWILDPSAEEVFIGETTGKLRR----KNPGASRTRLAAYRQAI 231
            |||||:||.|:||....||||:||.|||.:..:|  |....|||    |....|:.:  ..|..:
Human   123 NLSLNECFVKVPRDDKKPGKGSYWTLDPDSYNMF--ENGSFLRRRRRFKKKDVSKEK--EERAHL 183

  Fly   232 FSPMMAASPYGAPASSYGYPAVPFAA---------------AAAAAL-----YQRMNP-AAYQAA 275
            ..|        .||:|.|.||.|..|               ||:.||     .:.::| :|.|.:
Human   184 KEP--------PPAASKGAPATPHLADAPKEAEKKVVIKSEAASPALPVITKVETLSPESALQGS 240

  Fly   276 YQQMQYQQA-------PQAHHHQAPH 294
            .:......|       |: ||..||:
Human   241 PRSAASTPAGSPDGSLPE-HHAAAPN 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp1NP_476730.1 FH 120..205 CDD:214627 54/84 (64%)
FOXC2NP_005242.1 FH 72..160 CDD:214627 56/89 (63%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 167..208 12/50 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 232..268 9/35 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 383..420
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.