DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp1 and FOXE3

DIOPT Version :9

Sequence 1:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_036318.1 Gene:FOXE3 / 2301 HGNCID:3808 Length:319 Species:Homo sapiens


Alignment Length:218 Identity:78/218 - (35%)
Similarity:103/218 - (47%) Gaps:44/218 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 KPPYSYNALIMMAIQDSPEQRLTLNGIYQYLINRFPYFKANKRGWQNSIRHNLSLNKCFTKIPRS 184
            ||||||.|||.||:..:|.:||||..||:::..||.:::.:.|.|||||||||:||.||.|:||.
Human    71 KPPYSYIALIAMALAHAPGRRLTLAAIYRFITERFAFYRDSPRKWQNSIRHNLTLNDCFVKVPRE 135

  Fly   185 YDDPGKGNYWILDPSAEEVFIGETTGKLRRKNPGASRTRLAAYRQAIFSPMM--AASPYGAPA-- 245
            ..:|||||||.|||:|.::|   ..|...|:.....|..|.|:..|...|.:  ..:|| |||  
Human   136 PGNPGKGNYWTLDPAAADMF---DNGSFLRRRKRFKRAELPAHAAAAPGPPLPFPYAPY-APAPG 196

  Fly   246 ---------------------------------SSYGYPAVPFAAA--AAAALYQRMNPAAYQAA 275
                                             :..|.|..|..||  ||||.:.....||....
Human   197 PALLVPPPSAGPGPSPPARLFSVDSLVNLQPELAGLGAPEPPCCAAPDAAAAAFPPCAAAASPPL 261

  Fly   276 YQQMQYQQA-PQAHHHQAPHPAQ 297
            |.|:..:.. |.......|.||:
Human   262 YSQVPDRLVLPATRPGPGPLPAE 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp1NP_476730.1 FH 120..205 CDD:214627 48/84 (57%)
FOXE3NP_036318.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..69
FH 71..159 CDD:214627 49/90 (54%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.