DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp1 and FOXL1

DIOPT Version :9

Sequence 1:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_005241.1 Gene:FOXL1 / 2300 HGNCID:3817 Length:345 Species:Homo sapiens


Alignment Length:152 Identity:74/152 - (48%)
Similarity:96/152 - (63%) Gaps:17/152 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 KKPPYSYNALIMMAIQDSPEQRLTLNGIYQYLINRFPYFKANKRGWQNSIRHNLSLNKCFTKIPR 183
            :||||||.|||.|||||:||||:|||||||::::|||::..|::|||||||||||||.||.|:||
Human    48 QKPPYSYIALIAMAIQDAPEQRVTLNGIYQFIMDRFPFYHDNRQGWQNSIRHNLSLNDCFVKVPR 112

  Fly   184 SYDDPGKGNYWILDPSAEEVFIGETTGKLRRKN---------PGASRTRLAAYRQAIFSPMMAAS 239
            ....||||:||.|||...::|   ..|..||:.         |.|.|.|...::::..:...|.|
Human   113 EKGRPGKGSYWTLDPRCLDMF---ENGNYRRRKRKPKPGPGAPEAKRPRAETHQRSAEAQPEAGS 174

  Fly   240 PYGAPASSYGYPAVPFAAAAAA 261
              ||..|.   ||:....||.|
Human   175 --GAGGSG---PAISRLQAAPA 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp1NP_476730.1 FH 120..205 CDD:214627 56/84 (67%)
FOXL1NP_005241.1 FH 49..137 CDD:214627 57/90 (63%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 136..289 17/61 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.