DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp1 and FOXD1

DIOPT Version :9

Sequence 1:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_004463.1 Gene:FOXD1 / 2297 HGNCID:3802 Length:465 Species:Homo sapiens


Alignment Length:289 Identity:100/289 - (34%)
Similarity:129/289 - (44%) Gaps:89/289 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 DDELEDQLDEDQESED--------GNPSKKQKM--------------------TAGSDTK----K 120
            :||||| |:|:::.:|        |:|:.....                    :|||..|    |
Human    62 EDELED-LEEEEDDDDILLAPPAGGSPAPPGPAPAAGAGAGGGGGGGGAGGGGSAGSGAKNPLVK 125

  Fly   121 PPYSYNALIMMAIQDSPEQRLTLNGIYQYLINRFPYFKANKRGWQNSIRHNLSLNKCFTKIPRSY 185
            |||||.|||.|||..||::||||:.|.:::..||||::.....||||||||||||.||.||||..
Human   126 PPYSYIALITMAILQSPKKRLTLSEICEFISGRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREP 190

  Fly   186 DDPGKGNYWILDPSAEEVFIGETTGKLRRK-----------NPGASRTRL------------AAY 227
            .:|||||||.|||.:.::|  :....|||:           |..|:.:.|            .|.
Human   191 GNPGKGNYWTLDPESADMF--DNGSFLRRRKRFKRQPLLPPNAAAAESLLLRGAGAAGGAGDPAA 253

  Fly   228 RQAIFSPMMAASP-----------YGAPASSYGYPAVPFAAAAAAALYQRMNPAAYQAAYQQMQY 281
            ..|:|.|.....|           ||.....|..|:..||||||||       ||  ||:     
Human   254 AAALFPPAPPPPPHAYGYGPYGCGYGLQLPPYAPPSALFAAAAAAA-------AA--AAF----- 304

  Fly   282 QQAPQAHHHQAPHPAQMQGYPQQLNAELF 310
                  |.|..|.|....|...:|....|
Human   305 ------HPHSPPPPPPPHGAAAELARTAF 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp1NP_476730.1 FH 120..205 CDD:214627 51/84 (61%)
FOXD1NP_004463.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..117 11/55 (20%)
Forkhead 125..211 CDD:278670 52/87 (60%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 391..410
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.