DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp1 and FOXF2

DIOPT Version :9

Sequence 1:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001443.1 Gene:FOXF2 / 2295 HGNCID:3810 Length:444 Species:Homo sapiens


Alignment Length:306 Identity:96/306 - (31%)
Similarity:136/306 - (44%) Gaps:63/306 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 AKKPINTATQPIKTEPVHHHHQYVHPYSNSDGELSASEDFDSPSRTSTPMSSAAESLSSQNNDKL 83
            |..|:..|.|.....|         |.:.:....:|.|...|.|.:|:  :|.|.|.||.|:...
Human    15 ACSPVPGALQAALMSP---------PPAAAAAAAAAPETTSSSSSSSS--ASCASSSSSSNSASA 68

  Fly    84 DVEFDDELEDQLDEDQESEDGNPSKKQKMTAGSDT-----------------KKPPYSYNALIMM 131
                                  ||...|...|...                 :||||||.|||:|
Human    69 ----------------------PSAACKSAGGGGAGAGSGGAKKASSGLRRPEKPPYSYIALIVM 111

  Fly   132 AIQDSPEQRLTLNGIYQYLINRFPYFKANKRGWQNSIRHNLSLNKCFTKIPRSYDDPGKGNYWIL 196
            |||.||.:||||:.|||:|..|||:|:...:||:||:|||||||:||.|:|:....||||:||.:
Human   112 AIQSSPSKRLTLSEIYQFLQARFPFFRGAYQGWKNSVRHNLSLNECFIKLPKGLGRPGKGHYWTI 176

  Fly   197 DPSAEEVFIGETTGKLRRKNPGASRTRLAAYRQAIFSPMMAASPYGAPASSYGY-----PAVPFA 256
            ||::|.:|   ..|..||: |...|.:..|.: .::..:::...:||.....|:     |:.|..
Human   177 DPASEFMF---EEGSFRRR-PRGFRRKCQALK-PMYHRVVSGLGFGASLLPQGFDFQAPPSAPLG 236

  Fly   257 AAAAAALY--QRMNPAAYQAAYQQMQYQQAPQAHHHQAPHPAQMQG 300
            ..:... |  ..|.||.|.|......:......|||..||.:...|
Human   237 CHSQGG-YGGLDMMPAGYDAGAGAPSHAHPHHHHHHHVPHMSPNPG 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp1NP_476730.1 FH 120..205 CDD:214627 51/84 (61%)
FOXF2NP_001443.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 32..98 15/89 (17%)
FH 100..188 CDD:214627 52/90 (58%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 256..323 6/26 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 338..367
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.