Sequence 1: | NP_476730.1 | Gene: | slp1 / 33607 | FlyBaseID: | FBgn0003430 | Length: | 322 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001442.2 | Gene: | FOXF1 / 2294 | HGNCID: | 3809 | Length: | 379 | Species: | Homo sapiens |
Alignment Length: | 322 | Identity: | 99/322 - (30%) |
---|---|---|---|
Similarity: | 138/322 - (42%) | Gaps: | 114/322 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 106 PSKKQKMTAG-SDTKKPPYSYNALIMMAIQDSPEQRLTLNGIYQYLINRFPYFKANKRGWQNSIR 169
Fly 170 HNLSLNKCFTKIPRSYDDPGKGNYWILDPSAEEVFIGETTGKLRRKNPGASRTRLAAYRQAIFSP 234
Fly 235 M-----------------------------------------------MAASPY----------- 241
Fly 242 -------GAPASSYGY-----PAVPF------------------AAA----AAAAL-----YQRM 267
Fly 268 ------NPAAYQAAYQQMQYQQAPQAHHHQAPH--PAQMQGYPQ--QLNAELFQRMQFFGKF 319 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
slp1 | NP_476730.1 | FH | 120..205 | CDD:214627 | 51/84 (61%) |
FOXF1 | NP_001442.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..45 | 6/11 (55%) | |
FH | 48..136 | CDD:214627 | 52/90 (58%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG2294 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000010 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |