DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp1 and FOXJ3

DIOPT Version :9

Sequence 1:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster
Sequence 2:XP_005270689.1 Gene:FOXJ3 / 22887 HGNCID:29178 Length:630 Species:Homo sapiens


Alignment Length:197 Identity:68/197 - (34%)
Similarity:100/197 - (50%) Gaps:33/197 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 RTSTPMSSAAESLSSQNNDKLDVEFDDELEDQLDEDQESEDGNPSKKQKMTAGSDTKKPPYSYNA 127
            |.:...|.|.::.......|.:...|.......:|.|:.:||               ||||||.:
Human    44 RAAIQKSDATQNAHGTGISKKNALLDPNTTLDQEEVQQHKDG---------------KPPYSYAS 93

  Fly   128 LIMMAIQDSPEQRLTLNGIYQYLINRFPYFKANKRGWQNSIRHNLSLNKCFTKIPRSYDDPGKGN 192
            ||..||..||::::||:.|||::.:.|||::....||:|||||||||||||.|:|||.||||||:
Human    94 LITFAINSSPKKKMTLSEIYQWICDNFPYYREAGSGWKNSIRHNLSLNKCFLKVPRSKDDPGKGS 158

  Fly   193 YWILDPSAEEVFIGETTGKLRRKNPGASRTRLAAYRQAIFSPMMAASPYGAPASSYGYPAVPFAA 257
            ||.:|.:.:|..: .|..|.|.:                 |...|::||...:.|.|...:...:
Human   159 YWAIDTNPKEDVL-PTRPKKRAR-----------------SVERASTPYSIDSDSLGMECIISGS 205

  Fly   258 AA 259
            |:
Human   206 AS 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp1NP_476730.1 FH 120..205 CDD:214627 49/84 (58%)
FOXJ3XP_005270689.1 Forkhead 86..163 CDD:278670 47/76 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.