DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp1 and FOXK1

DIOPT Version :9

Sequence 1:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001032242.1 Gene:FOXK1 / 221937 HGNCID:23480 Length:733 Species:Homo sapiens


Alignment Length:236 Identity:74/236 - (31%)
Similarity:117/236 - (49%) Gaps:32/236 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 KPINTATQPIKTE-PVHHHHQYVHPYSNSDGELSASEDFDSPSRTSTPMSSAAESLSSQNNDKLD 84
            :|:.....|:|.. |.......|.|..:..|.:|...     |..::|..:.:.|.....|...|
Human   216 RPLYPQISPLKIHIPEPDLRSMVSPVPSPTGTISVPN-----SCPASPRGAGSSSYRFVQNVTSD 275

  Fly    85 VEFDDELEDQLDEDQESE-DGNPSKKQKMTAGSDTKKPPYSYNALIMMAIQDSPEQRLTLNGIYQ 148
            ::...|...:...:|::: .|..|.|       |..|||:||..||:.||..:.:::|||:|||.
Human   276 LQLAAEFAAKAASEQQADTSGGDSPK-------DESKPPFSYAQLIVQAISSAQDRQLTLSGIYA 333

  Fly   149 YLINRFPYFKANKRGWQNSIRHNLSLNKCFTKIPRSYDDPGKGNYWILDPSAEEVFIGETTGKLR 213
            ::...:||::...:|||||||||||||:.|.|:|||.::||||::|.:||::|...:.:...|.|
Human   334 HITKHYPYYRTADKGWQNSIRHNLSLNRYFIKVPRSQEEPGKGSFWRIDPASEAKLVEQAFRKRR 398

  Fly   214 RKNPGASRTRLAAYRQAIFSPMMAASPYGAPASSYGYPAVP 254
            ::.....||                 |:| |.||...||.|
Human   399 QRGVSCFRT-----------------PFG-PLSSRSAPASP 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp1NP_476730.1 FH 120..205 CDD:214627 43/84 (51%)
FOXK1NP_001032242.1 Interaction with SIN3A and SIN3B. /evidence=ECO:0000250|UniProtKB:P42128 2..40
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 36..79
Required for interaction with FOXO4 and MEF2C. /evidence=ECO:0000250|UniProtKB:P42128 95..420 72/233 (31%)
FHA <102..204 CDD:224630
FHA 110..203 CDD:238017
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 287..306 5/25 (20%)
Forkhead 305..391 CDD:278670 43/85 (51%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 413..436 5/9 (56%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 676..733
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.