DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp1 and FOXD4L1

DIOPT Version :9

Sequence 1:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_036316.1 Gene:FOXD4L1 / 200350 HGNCID:18521 Length:408 Species:Homo sapiens


Alignment Length:289 Identity:95/289 - (32%)
Similarity:125/289 - (43%) Gaps:83/289 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 RTSTPMSSAAESL--SSQNNDKLDVEFDDELEDQLDEDQES------------------------ 101
            |...|.|:...||  |...:.|:||..::|.||::::::|.                        
Human     5 RAERPRSTPQRSLRDSDGEDGKIDVLGEEEDEDEVEDEEEEASQKFLEQSLQPGLQVARWGGVAL 69

  Fly   102 -----EDGNPSKKQKM-----------TAGSDTK---KPPYSYNALIMMAIQDSPEQRLTLNGIY 147
                 |.|.||...:.           .|..|.:   ||||||.|||.|||..||.:||||:||.
Human    70 PREHIEGGGPSDPSEFGTEFRAPPRSAAASEDARQPAKPPYSYIALITMAILQSPHKRLTLSGIC 134

  Fly   148 QYLINRFPYFKANKRGWQNSIRHNLSLNKCFTKIPRSYDDPGKGNYWILDPSAEEVFIGETTGKL 212
            .::..||||::.....||||||||||||.||.||||....||||.||.|||:::::|  :....|
Human   135 AFISGRFPYYRRKFPAWQNSIRHNLSLNDCFVKIPREPGHPGKGTYWSLDPASQDMF--DNGSFL 197

  Fly   213 RRK--------NPGASRTR---LAAYRQAIFSPMMAASPYGAPASSYGYPAVPFAAAAAAALYQR 266
            ||:        .|||....   |.|...|:.:|        .|....|.||:|            
Human   198 RRRKRFKRHQLTPGAHLPHPFPLPAAHAALHNP--------RPGPLLGAPALP------------ 242

  Fly   267 MNPAAYQAAYQQMQYQQAPQAHHHQAPHP 295
             .|.  ..||......:.|.|..|  |||
Human   243 -QPV--PGAYPNTAPGRRPYALLH--PHP 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp1NP_476730.1 FH 120..205 CDD:214627 51/84 (61%)
FOXD4L1NP_036316.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..54 13/48 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 71..104 6/32 (19%)
Forkhead 107..193 CDD:278670 52/87 (60%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 385..408
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.