DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp1 and fkh-10

DIOPT Version :9

Sequence 1:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_492676.2 Gene:fkh-10 / 182874 WormBaseID:WBGene00001442 Length:194 Species:Caenorhabditis elegans


Alignment Length:189 Identity:57/189 - (30%)
Similarity:95/189 - (50%) Gaps:27/189 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 MSSAAESLSSQNNDKLDVEFDDELEDQLDEDQESEDGNPSKKQKMTAGSDTKKPPYSYNALIMMA 132
            :||:..||.......:.:.||..:.            :|::.|:       .||.:||..||.||
 Worm     9 LSSSNHSLKDSPFPMIPLSFDTSIM------------SPTECQQ-------PKPQHSYIGLIAMA 54

  Fly   133 IQDSPEQRLTLNGIYQYLINRFPYFKANKRGWQNSIRHNLSLNKCFTKIPRSYDDPGKGNYWILD 197
            |..||::::.|..:|::::|.:|||::...||:||||||||||.||.|..|:.:  |||:||.:.
 Worm    55 ILSSPQKKMVLAEVYEWIMNEYPYFRSRGAGWRNSIRHNLSLNDCFVKAGRAAN--GKGHYWAVH 117

  Fly   198 PSAEEVFIGETTGKLRRKNPGASRTRLAAYRQAIFSPMMAASPYGAPASSYGYPAVPFA 256
            |:..:.|   ..|..||:.   ::.::..:.........::...|:|.|....|..|.|
 Worm   118 PACVKDF---ERGDFRRRR---AQRKVRRHMGLQVEDGDSSDEEGSPGSDPSPPIFPTA 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp1NP_476730.1 FH 120..205 CDD:214627 39/84 (46%)
fkh-10NP_492676.2 Forkhead 41..125 CDD:365978 40/88 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.