DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp1 and fkh-6

DIOPT Version :9

Sequence 1:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_494775.1 Gene:fkh-6 / 181907 WormBaseID:WBGene00001438 Length:323 Species:Caenorhabditis elegans


Alignment Length:87 Identity:48/87 - (55%)
Similarity:60/87 - (68%) Gaps:7/87 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 GSDTKKPPYSYNALIMMAIQDSPEQRLTLNGIYQYLINRFPYFK----ANKRGWQNSIRHNLSLN 175
            |:...||||||.|||.|||..||::|:|||.||:::..:|||::    ..|:|||||||||||||
 Worm    16 GNSIDKPPYSYVALIAMAIDASPDKRMTLNQIYKFIEAKFPYYRDADAKRKQGWQNSIRHNLSLN 80

  Fly   176 KCFTKIPR---SYDDPGKGNYW 194
            .||.|..|   |..:..|||||
 Worm    81 DCFVKKARDGQSCANDRKGNYW 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp1NP_476730.1 FH 120..205 CDD:214627 47/82 (57%)
fkh-6NP_494775.1 FH 21..116 CDD:214627 47/82 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.