DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp1 and fkh-9

DIOPT Version :9

Sequence 1:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001024760.1 Gene:fkh-9 / 180670 WormBaseID:WBGene00001441 Length:300 Species:Caenorhabditis elegans


Alignment Length:214 Identity:61/214 - (28%)
Similarity:87/214 - (40%) Gaps:75/214 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KSNFSIDAILAKKPINTATQPIKTEPVHHHHQYVHPYSNSDGELSASEDFDSPSRTSTPMSSAAE 73
            |.|.::|.:.:...|.:|:..||.|                   :.|.....||...||:::|  
 Worm    16 KQNITMDLLRSPIQIPSASDTIKIE-------------------TPSTISSQPSPIQTPLAAA-- 59

  Fly    74 SLSSQNNDKLDVEFDDELEDQLDEDQESEDGNPSKKQKMTAGSDTKKPPYSYNALIMMAIQDSPE 138
              ||.|                                      .::|..||..||:.||..|||
 Worm    60 --SSDN--------------------------------------FERPSLSYKDLIIEAIDRSPE 84

  Fly   139 QRLTLNGIYQYLINRFPYF--KANKRGWQNSIRHNLSLNKCFTKIPRSYDDPG--KGNYWILDPS 199
            :||.||.|||.:....||:  :.::.||||||||||||:.||.|:|.......  .|::|.:.| 
 Worm    85 KRLKLNEIYQVIRLLHPYYRHRPDQWGWQNSIRHNLSLHDCFVKLPLKQTSASGVVGHFWTVVP- 148

  Fly   200 AEEVFIGETTGK--LRRKN 216
                   |.:.|  |||:|
 Worm   149 -------ELSDKQTLRRRN 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp1NP_476730.1 FH 120..205 CDD:214627 38/88 (43%)
fkh-9NP_001024760.1 FH 66..153 CDD:214627 39/94 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.