DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp1 and fkh-2

DIOPT Version :9

Sequence 1:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_508644.1 Gene:fkh-2 / 180663 WormBaseID:WBGene00001434 Length:270 Species:Caenorhabditis elegans


Alignment Length:262 Identity:111/262 - (42%)
Similarity:150/262 - (57%) Gaps:36/262 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 STPMSSAAESLSSQNNDKLDVEFDDELEDQLDEDQESEDG---NPSKKQKMTAGSDTKKPPYSYN 126
            ||.:|..:.|:.:.:....|...|:.::|:..|...|:|.   :.|..::.|..|...|||:|||
 Worm    35 STDISDPSTSIDTTDTMSTDYLHDESIDDERSESTLSKDSKSPSSSNSEEKTPSSPNDKPPFSYN 99

  Fly   127 ALIMMAIQDSPEQRLTLNGIYQYLINRFPYFKANKRGWQNSIRHNLSLNKCFTKIPRSYDDPGKG 191
            |||||||:||||:||||.|||:|::..:|:::.||:||||||||||||||||.|:||::||||||
 Worm   100 ALIMMAIKDSPEKRLTLAGIYEYIVTNYPFYRDNKQGWQNSIRHNLSLNKCFVKVPRNFDDPGKG 164

  Fly   192 NYWILDPSAE-EVFIGETTGKLRRKNPGASRTRLAAYRQAIFSPMMAASPYGAPASSYGYPAVPF 255
            |||:||.:|| |||||..||||||:....||.|:.||:|                  ||      
 Worm   165 NYWMLDATAEDEVFIGGATGKLRRRPSSLSRARMDAYKQ------------------YG------ 205

  Fly   256 AAAAAAALYQRMNPAAYQAAYQQMQYQQAPQAH--HHQAPHPAQMQGY--PQQLNAELFQRMQFF 316
              ||||.|:...:|.  ..|..:..|..||...  ....|.||..|.:  |:.|...:.|:...|
 Worm   206 --AAAANLFPYFSPG--MPALPRHPYLTAPNGFLPRQMMPIPAMPQVFAQPELLQLYINQQQSLF 266

  Fly   317 GK 318
            .|
 Worm   267 TK 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp1NP_476730.1 FH 120..205 CDD:214627 62/85 (73%)
fkh-2NP_508644.1 FH 93..170 CDD:238016 56/76 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 192 1.000 Inparanoid score I2551
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 1 1.000 - - otm14760
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1751
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.970

Return to query results.
Submit another query.