DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp1 and Foxk1

DIOPT Version :9

Sequence 1:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_951031.2 Gene:Foxk1 / 17425 MGIID:1347488 Length:719 Species:Mus musculus


Alignment Length:236 Identity:75/236 - (31%)
Similarity:117/236 - (49%) Gaps:32/236 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 KPINTATQPIKTE-PVHHHHQYVHPYSNSDGELSASEDFDSPSRTSTPMSSAAESLSSQNNDKLD 84
            :|:.....|:|.. |.......|.|..:..|.:|...     |..::|..:.:.|.....|...|
Mouse   202 RPLYPQISPLKIHIPEPDLRSLVSPIPSPTGTISVPN-----SCPASPRGAGSSSYRFVQNVTSD 261

  Fly    85 VEFDDELEDQLDEDQESE-DGNPSKKQKMTAGSDTKKPPYSYNALIMMAIQDSPEQRLTLNGIYQ 148
            ::...|...:...:|::: .|..|.|       |..||||||..||:.||..:.:::|||:|||.
Mouse   262 LQLAAEFAAKAASEQQADASGGDSPK-------DESKPPYSYAQLIVQAISSAQDRQLTLSGIYA 319

  Fly   149 YLINRFPYFKANKRGWQNSIRHNLSLNKCFTKIPRSYDDPGKGNYWILDPSAEEVFIGETTGKLR 213
            ::...:||::...:|||||||||||||:.|.|:|||.::||||::|.:||::|...:.:...|.|
Mouse   320 HITKHYPYYRTADKGWQNSIRHNLSLNRYFIKVPRSQEEPGKGSFWRIDPASEAKLVEQAFRKRR 384

  Fly   214 RKNPGASRTRLAAYRQAIFSPMMAASPYGAPASSYGYPAVP 254
            ::.....||                 |:| |.||...||.|
Mouse   385 QRGVSCFRT-----------------PFG-PLSSRSAPASP 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp1NP_476730.1 FH 120..205 CDD:214627 44/84 (52%)
Foxk1NP_951031.2 Interaction with SIN3A and SIN3B. /evidence=ECO:0000269|PubMed:10620510, ECO:0000269|PubMed:22476904 2..40
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 35..67
Required for interaction with FOXO4 and MEF2C. /evidence=ECO:0000269|PubMed:22956541 81..406 73/233 (31%)
FHA <88..190 CDD:224630
FHA 96..189 CDD:238017
Forkhead 291..377 CDD:278670 44/85 (52%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 399..443 5/9 (56%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 665..719
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.