DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp1 and lin-31

DIOPT Version :9

Sequence 1:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_494704.1 Gene:lin-31 / 173740 WormBaseID:WBGene00003017 Length:237 Species:Caenorhabditis elegans


Alignment Length:163 Identity:60/163 - (36%)
Similarity:82/163 - (50%) Gaps:40/163 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 DTKKPPYSYNALIMMAIQDSPEQRLTLNGIYQYLINRFPYFKANKRGWQNSIRHNLSLNKCFTKI 181
            |.:||||||..|..||||||.::.|.|..||:|:::|||:::.|.:.||||:|||||.|.||.||
 Worm    10 DEQKPPYSYIWLTYMAIQDSDDKMLPLTEIYKYIMDRFPFYRKNTQRWQNSLRHNLSFNDCFIKI 74

  Fly   182 PRSYDDPGKGNYWILDPSA-------------------------EEVFIGETTGKLRRKNPGASR 221
            ||..|.||||:||.:.|:|                         ::.|......|:.||||    
 Worm    75 PRRADRPGKGSYWAVHPNASGMFENGSCLRRRKRFRARGGQDDDDDDFHHPAPSKISRKNP---- 135

  Fly   222 TRLAAYRQAIFSPMMAASPYGAPASSYGYPAVP 254
                       .|::...|...|..|..:|.:|
 Worm   136 -----------LPLLPEPPITPPLLSSLFPNLP 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp1NP_476730.1 FH 120..205 CDD:214627 47/109 (43%)
lin-31NP_494704.1 FH 13..101 CDD:214627 47/87 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1826
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.900

Return to query results.
Submit another query.