DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp1 and Foxc2

DIOPT Version :9

Sequence 1:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001095150.1 Gene:Foxc2 / 171356 RGDID:621703 Length:494 Species:Rattus norvegicus


Alignment Length:290 Identity:88/290 - (30%)
Similarity:118/290 - (40%) Gaps:109/290 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 AGSDTKKPPYSYNALIMMAIQDSPEQRLTLNGIYQYLINRFPYFKANKRGWQNSIRHNLSLNKCF 178
            |..|..||||||.|||.||||::||:::|||||||::::|||:::.||:|||||||||||||:||
  Rat    65 APKDLVKPPYSYIALITMAIQNAPEKKITLNGIYQFIMDRFPFYRENKQGWQNSIRHNLSLNECF 129

  Fly   179 TKIPRSYDDPGKGNYWILDPSAEEVFIGETTGKLRRKN--------------------PGAS--- 220
            .|:||....||||:||.|||.:..:|  |....|||:.                    |.||   
  Rat   130 VKVPRDDKKPGKGSYWTLDPDSYNMF--ENGSFLRRRRRFKKKDVPKDKEERAHLKEPPPASAKG 192

  Fly   221 --------------------RTRLAAYRQAIFSPMMAASPYGA----PASSYGYP---------- 251
                                ::..|:....:.:.:...||.||    |.||...|          
  Rat   193 APTGTPVADGPKEAEKKVVVKSEAASPALPVITKVETLSPEGALQASPRSSASTPAGSPDGSLPE 257

  Fly   252 -------------------------------------------AVPFAAAAAAALYQ-------R 266
                                                       |:|:|||..||..|       .
  Rat   258 HHAAAPNGLPGFSVETIMTLRTSPPGGDLSPAAARAGLVVPPLALPYAAAPPAAYAQPCAQGLEA 322

  Fly   267 MNPAAYQAAYQQMQYQQAPQAHHHQAPHPA 296
            ...|.||.:.:.|......:...|....||
  Rat   323 AGSAGYQCSMRAMSLYTGAERPAHVCVPPA 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp1NP_476730.1 FH 120..205 CDD:214627 54/84 (64%)
Foxc2NP_001095150.1 FH_FOXC1 66..158 CDD:410818 57/93 (61%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 166..213 3/46 (7%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 233..267 6/33 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 380..422
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.