DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp1 and Foxd1

DIOPT Version :9

Sequence 1:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_032268.2 Gene:Foxd1 / 15229 MGIID:1347463 Length:456 Species:Mus musculus


Alignment Length:347 Identity:103/347 - (29%)
Similarity:133/347 - (38%) Gaps:127/347 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 STPMSSAAESLSSQNNDKLDVEFDDELEDQLDEDQESEDGN-------PS---KKQKMTAGSD-- 117
            ||.||.|:......:.|.:....|||.|:  |:|.|...|.       ||   ::::..||.|  
Mouse     4 STEMSDASGLAEETDIDVVGEGEDDEEEE--DDDDEGGGGRGGGGSRLPSSAQRRRRSYAGEDDL 66

  Fly   118 -------------------------------------------------------------TKKP 121
                                                                         ..||
Mouse    67 EDLEEEDDDDLLLASRPAASPAPPGPAPAPGTGSGGCSGAGAGGGAGGGTGAGTGGGAKNPLVKP 131

  Fly   122 PYSYNALIMMAIQDSPEQRLTLNGIYQYLINRFPYFKANKRGWQNSIRHNLSLNKCFTKIPRSYD 186
            ||||.|||.|||..||::||||:.|.:::.:||||::.....||||||||||||.||.||||...
Mouse   132 PYSYIALITMAILQSPKKRLTLSEICEFISSRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPG 196

  Fly   187 DPGKGNYWILDPSAEEVFIGETTGKLRRKNPGASRTRLAAYRQAIFSPMMAASP----------- 240
            :|||||||.|||.:.::|  :....|||:.....:..||.:..|....:..|.|           
Mouse   197 NPGKGNYWTLDPESADMF--DNGSFLRRRKRFKRQPLLAPHAAAEALLLRGAGPAAGAGDPGAAL 259

  Fly   241 -----------YGAPASSYGY-------PAVPFAAAAAAALYQRMNPAAYQAAYQQMQYQQAPQA 287
                       |||...:||.       |:..||||||||          .||:           
Mouse   260 FPPPPPPPACGYGAYGCAYGLQLPPCAPPSALFAAAAAAA----------AAAF----------- 303

  Fly   288 HHHQAPHPAQMQGYPQQLNAEL 309
            |.|..|.|......|....|||
Mouse   304 HPHSPPPPPPPPPPPPGAAAEL 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp1NP_476730.1 FH 120..205 CDD:214627 51/84 (61%)
Foxd1NP_032268.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..104 19/101 (19%)
Forkhead 130..216 CDD:278670 52/87 (60%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 303..322 5/29 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 381..401
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.