Sequence 1: | NP_476730.1 | Gene: | slp1 / 33607 | FlyBaseID: | FBgn0003430 | Length: | 322 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_034556.2 | Gene: | Foxf1 / 15227 | MGIID: | 1347470 | Length: | 378 | Species: | Mus musculus |
Alignment Length: | 320 | Identity: | 92/320 - (28%) |
---|---|---|---|
Similarity: | 130/320 - (40%) | Gaps: | 111/320 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 106 PSKKQKMTAG-SDTKKPPYSYNALIMMAIQDSPEQRLTLNGIYQYLINRFPYFKANKRGWQNSIR 169
Fly 170 HNLSLNKCFTKIPRSYDDPGKGNYWILDPSAEEVFIGETTGKLRRKNPGASRTRLAAYRQAI--- 231
Fly 232 ----------------------------------------------------------------- 231
Fly 232 --------------------FSPMMAASPYGA--PASSYGYPAVPFAAAAAAAL-----YQRM-- 267
Fly 268 ----NPAAYQAAYQQMQYQQAPQAHHHQAPH--PAQMQGYPQ--QLNAELFQRMQFFGKF 319 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
slp1 | NP_476730.1 | FH | 120..205 | CDD:214627 | 51/84 (61%) |
Foxf1 | NP_034556.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..45 | 5/11 (45%) | |
Forkhead | 48..133 | CDD:306709 | 52/87 (60%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG2294 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000010 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |