DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp1 and Foxf1

DIOPT Version :9

Sequence 1:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_034556.2 Gene:Foxf1 / 15227 MGIID:1347470 Length:378 Species:Mus musculus


Alignment Length:320 Identity:92/320 - (28%)
Similarity:130/320 - (40%) Gaps:111/320 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 PSKKQKMTAG-SDTKKPPYSYNALIMMAIQDSPEQRLTLNGIYQYLINRFPYFKANKRGWQNSIR 169
            |:|.:|..|| ...:||||||.|||:||||.||.:||||:.|||:|..|||:|:...:||:||:|
Mouse    33 PTKAKKTNAGVRRPEKPPYSYIALIVMAIQSSPSKRLTLSEIYQFLQARFPFFRGAYQGWKNSVR 97

  Fly   170 HNLSLNKCFTKIPRSYDDPGKGNYWILDPSAEEVFIGETTGKLRRKNPGASRTRLAAYRQAI--- 231
            ||||||:||.|:|:....||||:||.:||::|.:|   ..|..||: |...|.:..|.:...   
Mouse    98 HNLSLNECFIKLPKGLGRPGKGHYWTIDPASEFMF---EEGSFRRR-PRGFRRKCQALKPVYSMV 158

  Fly   232 ----------------------------------------------------------------- 231
                                                                             
Mouse   159 NGLGFNHLPDTYGFQGSGGLSCAPNSLALEGGLGMMNGHLAGNVDGMALPSHSVPHLPSNGGHSY 223

  Fly   232 --------------------FSPMMAASPYGA--PASSYGYPAVPFAAAAAAAL-----YQRM-- 267
                                .||::.|...|.  |.:.|...|..:..||:|||     |.:.  
Mouse   224 MGGCGGSAAGEYPHHDSSVPASPLLPAGAGGVMEPHAVYSSSAAAWPPAASAALNSGASYIKQQP 288

  Fly   268 ----NPAAYQAAYQQMQYQQAPQAHHHQAPH--PAQMQGYPQ--QLNAELFQRMQFFGKF 319
                ||||...: ..:......|.:.||..|  ||::||.|:  ..:..:..|.:|...|
Mouse   289 LSPCNPAANPLS-GSISTHSLEQPYLHQNSHNGPAELQGIPRYHSQSPSMCDRKEFVFSF 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp1NP_476730.1 FH 120..205 CDD:214627 51/84 (61%)
Foxf1NP_034556.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..45 5/11 (45%)
Forkhead 48..133 CDD:306709 52/87 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.