DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp1 and Foxd3

DIOPT Version :9

Sequence 1:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_034555.3 Gene:Foxd3 / 15221 MGIID:1347473 Length:469 Species:Mus musculus


Alignment Length:310 Identity:103/310 - (33%)
Similarity:135/310 - (43%) Gaps:75/310 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 PVHHHHQYVHPYSNSDGELSASEDFDSPSR-TSTPMSSAAESLSSQNNDKLDVEFDDELEDQLDE 97
            ||..||....|.:     |:...:...|.. |..|.:...:.                     .|
Mouse    63 PVSAHHGQSQPQA-----LALPTEATGPGNDTGAPEADGCKG---------------------GE 101

  Fly    98 DQESEDGNPSKKQKMTAG-------SDTKKPPYSYNALIMMAIQDSPEQRLTLNGIYQYLINRFP 155
            |..:..|.|......|.|       :...||||||.|||.|||..||:::|||:||.:::.||||
Mouse   102 DAVTGGGGPGAGSGATGGLTPNKPKNSLVKPPYSYIALITMAILQSPQKKLTLSGICEFISNRFP 166

  Fly   156 YFKANKRGWQNSIRHNLSLNKCFTKIPRSYDDPGKGNYWILDPSAEEVFIGETTGKLRRK----- 215
            |::.....||||||||||||.||.||||...:|||||||.|||.:|::|  :....|||:     
Mouse   167 YYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTLDPQSEDMF--DNGSFLRRRKRFKR 229

  Fly   216 -NPGASRTRLAAYRQAIFSPMMAAS----PYGAP--------ASSYGYPAVPFAAAAAAALYQRM 267
             .....|.:.|...|:..:..:||:    |||.|        |.:|.:||...||||||||    
Mouse   230 HQQEHLREQTALMMQSFGAYSLAAAAGAGPYGRPYGLHPAAAAGAYSHPAAAAAAAAAAAL---- 290

  Fly   268 NPAAYQAAYQQMQYQQAPQAHHHQAPHPAQMQGYPQQLNAELFQRMQFFG 317
                      |..|...|.|       |......|...:.||.::...||
Mouse   291 ----------QYPYALPPVA-------PVLPPAVPLLPSGELGRKAAAFG 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp1NP_476730.1 FH 120..205 CDD:214627 53/84 (63%)
Foxd3NP_034555.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..127 15/89 (17%)
Forkhead 131..217 CDD:278670 54/87 (62%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 379..409
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.950

Return to query results.
Submit another query.