DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp1 and Foxd4

DIOPT Version :9

Sequence 1:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_032048.1 Gene:Foxd4 / 14237 MGIID:1347467 Length:444 Species:Mus musculus


Alignment Length:286 Identity:95/286 - (33%)
Similarity:125/286 - (43%) Gaps:78/286 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 STPMSSAAESLSSQNNDKLDVEFDDELEDQLDEDQESEDGN------------------------ 105
            |||..|...  |.|:..::||..::|..||.:|:.:.|:.:                        
Mouse    11 STPPPSPLS--SDQDEVEIDVLAEEEDGDQTEEEDDEEESHKCLERSLQRPGARTLAGRSAGDCG 73

  Fly   106 --------------PSKKQKMTA-GSDTKKPPYSYNALIMMAIQDSPEQRLTLNGIYQYLINRFP 155
                          |......|| |....||||||.|||.|||..||.:||||:||..::..|||
Mouse    74 DLSNSSGFLRKFRAPRTPATTTADGPQPAKPPYSYIALITMAILQSPHKRLTLSGICAFISGRFP 138

  Fly   156 YFKANKRGWQNSIRHNLSLNKCFTKIPRSYDDPGKGNYWILDPSAEEVFIGETTGKLRRKNPGAS 220
            |::.....||||||||||||.||.||||....|||||||.|||:::::|  :....|||      
Mouse   139 YYRRKFPAWQNSIRHNLSLNDCFVKIPREPGHPGKGNYWSLDPASQDMF--DNGSFLRR------ 195

  Fly   221 RTRLAAYRQAIFSPMMAASPYGAPASSYGYPAVPFAAAAAAALYQRMNPAAYQAAYQQMQYQQAP 285
            |.|...:.               |.|. |:|..||...|..|......|:..      ::|...|
Mouse   196 RKRFKRHH---------------PPSG-GHPHCPFPPPAVPATLHVSQPSLL------LRYSAPP 238

  Fly   286 Q---AHHHQAP---HP-AQMQGYPQQ 304
            |   |.|..||   || |.:..:|.:
Mouse   239 QPNLAAHPAAPPRSHPCAPLHPHPMR 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp1NP_476730.1 FH 120..205 CDD:214627 52/84 (62%)
Foxd4NP_032048.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..70 13/60 (22%)
Forkhead 103..189 CDD:278670 53/87 (61%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 234..256 9/21 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.