DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp1 and Foxc2

DIOPT Version :10

Sequence 1:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_038547.2 Gene:Foxc2 / 14234 MGIID:1347481 Length:494 Species:Mus musculus


Alignment Length:205 Identity:84/205 - (40%)
Similarity:116/205 - (56%) Gaps:29/205 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 AGSDTKKPPYSYNALIMMAIQDSPEQRLTLNGIYQYLINRFPYFKANKRGWQNSIRHNLSLNKCF 178
            |..|..||||||.|||.||||::||:::|||||||::::|||:::.||:|||||||||||||:||
Mouse    65 APKDLVKPPYSYIALITMAIQNAPEKKITLNGIYQFIMDRFPFYRENKQGWQNSIRHNLSLNECF 129

  Fly   179 TKIPRSYDDPGKGNYWILDPSAEEVFIGETTGKLRRKN-------PGASRTRLAAYRQAIFSPMM 236
            .|:||....||||:||.|||.:..:|  |....|||:.       |.....|  |:.:...|...
Mouse   130 VKVPRDDKKPGKGSYWTLDPDSYNMF--ENGSFLRRRRRFKKKDVPKDKEER--AHLKEPPSTTA 190

  Fly   237 AASPYGAPASSYGYPA----VPFAAAAAAAL-----YQRMNP-AAYQAAYQQMQYQQA------- 284
            ..:|.|.|.:.....|    |..:.||:.||     .:.::| .|.||:.:......|       
Mouse   191 KGAPTGTPVADGPKEAEKKVVVKSEAASPALPVITKVETLSPEGALQASPRSASSTPAGSPDGSL 255

  Fly   285 PQAHHHQAPH 294
            |: ||..||:
Mouse   256 PE-HHAAAPN 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp1NP_476730.1 COG5025 <11..>230 CDD:227358 64/122 (52%)
Forkhead 120..205 CDD:459732 54/84 (64%)
Foxc2NP_038547.2 FH_FOXC1 66..158 CDD:410818 57/93 (61%)
COG5025 71..>251 CDD:227358 77/183 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 166..213 9/48 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 233..267 9/33 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 381..422
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.