Sequence 1: | NP_476730.1 | Gene: | slp1 / 33607 | FlyBaseID: | FBgn0003430 | Length: | 322 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_038547.2 | Gene: | Foxc2 / 14234 | MGIID: | 1347481 | Length: | 494 | Species: | Mus musculus |
Alignment Length: | 205 | Identity: | 84/205 - (40%) |
---|---|---|---|
Similarity: | 116/205 - (56%) | Gaps: | 29/205 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 114 AGSDTKKPPYSYNALIMMAIQDSPEQRLTLNGIYQYLINRFPYFKANKRGWQNSIRHNLSLNKCF 178
Fly 179 TKIPRSYDDPGKGNYWILDPSAEEVFIGETTGKLRRKN-------PGASRTRLAAYRQAIFSPMM 236
Fly 237 AASPYGAPASSYGYPA----VPFAAAAAAAL-----YQRMNP-AAYQAAYQQMQYQQA------- 284
Fly 285 PQAHHHQAPH 294 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
slp1 | NP_476730.1 | FH | 120..205 | CDD:214627 | 54/84 (64%) |
Foxc2 | NP_038547.2 | FH | 71..159 | CDD:214627 | 56/89 (63%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 166..213 | 9/48 (19%) | |||
EBP50_C | 167..>257 | CDD:286142 | 18/91 (20%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 233..267 | 9/33 (27%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 381..422 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG2294 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1270467at2759 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0000010 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
5 | 4.820 |