DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp1 and Foxc2

DIOPT Version :9

Sequence 1:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_038547.2 Gene:Foxc2 / 14234 MGIID:1347481 Length:494 Species:Mus musculus


Alignment Length:205 Identity:84/205 - (40%)
Similarity:116/205 - (56%) Gaps:29/205 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 AGSDTKKPPYSYNALIMMAIQDSPEQRLTLNGIYQYLINRFPYFKANKRGWQNSIRHNLSLNKCF 178
            |..|..||||||.|||.||||::||:::|||||||::::|||:::.||:|||||||||||||:||
Mouse    65 APKDLVKPPYSYIALITMAIQNAPEKKITLNGIYQFIMDRFPFYRENKQGWQNSIRHNLSLNECF 129

  Fly   179 TKIPRSYDDPGKGNYWILDPSAEEVFIGETTGKLRRKN-------PGASRTRLAAYRQAIFSPMM 236
            .|:||....||||:||.|||.:..:|  |....|||:.       |.....|  |:.:...|...
Mouse   130 VKVPRDDKKPGKGSYWTLDPDSYNMF--ENGSFLRRRRRFKKKDVPKDKEER--AHLKEPPSTTA 190

  Fly   237 AASPYGAPASSYGYPA----VPFAAAAAAAL-----YQRMNP-AAYQAAYQQMQYQQA------- 284
            ..:|.|.|.:.....|    |..:.||:.||     .:.::| .|.||:.:......|       
Mouse   191 KGAPTGTPVADGPKEAEKKVVVKSEAASPALPVITKVETLSPEGALQASPRSASSTPAGSPDGSL 255

  Fly   285 PQAHHHQAPH 294
            |: ||..||:
Mouse   256 PE-HHAAAPN 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp1NP_476730.1 FH 120..205 CDD:214627 54/84 (64%)
Foxc2NP_038547.2 FH 71..159 CDD:214627 56/89 (63%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 166..213 9/48 (19%)
EBP50_C 167..>257 CDD:286142 18/91 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 233..267 9/33 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 381..422
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.