DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp1 and Foxi1

DIOPT Version :10

Sequence 1:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_076396.3 Gene:Foxi1 / 14233 MGIID:1096329 Length:372 Species:Mus musculus


Alignment Length:136 Identity:69/136 - (50%)
Similarity:94/136 - (69%) Gaps:6/136 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 PSKKQKMTAGSDTKKPPYSYNALIMMAIQDSPEQRLTLNGIYQYLINRFPYFKANKRGWQNSIRH 170
            ||:::.|    ...:|||||:|||.|||..:|:|||||:.||||:.:.||::..:|.||||||||
Mouse   107 PSQEELM----KLVRPPYSYSALIAMAIHGAPDQRLTLSQIYQYVADNFPFYNKSKAGWQNSIRH 167

  Fly   171 NLSLNKCFTKIPRSYDDPGKGNYWILDPSAEEVF-IGETTGKLRRKNPGASRTRLAAYRQAIFSP 234
            |||||.||.|:||..|||||||||.|||:.|::| .|....|.:||:..:|.|...| .:...:.
Mouse   168 NLSLNDCFKKVPRDEDDPGKGNYWTLDPNCEKMFDNGNFRRKRKRKSDSSSSTSSLA-SEKTENG 231

  Fly   235 MMAASP 240
            ::|:||
Mouse   232 LLASSP 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp1NP_476730.1 COG5025 <11..>230 CDD:227358 66/124 (53%)
Forkhead 120..205 CDD:459732 56/85 (66%)
Foxi1NP_076396.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23
FH_FOXI1 114..213 CDD:410827 58/98 (59%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 202..271 10/37 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.