Sequence 1: | NP_476730.1 | Gene: | slp1 / 33607 | FlyBaseID: | FBgn0003430 | Length: | 322 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_032015.1 | Gene: | Foxh1 / 14106 | MGIID: | 1347465 | Length: | 401 | Species: | Mus musculus |
Alignment Length: | 229 | Identity: | 66/229 - (28%) |
---|---|---|---|
Similarity: | 103/229 - (44%) | Gaps: | 43/229 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 60 SPSRTSTPMSSAAESLSSQNNDKLDVEFDDELEDQLDEDQESEDGNPSKKQKMTAGSDTKKPPYS 124
Fly 125 YNALIMMAIQDSPEQRLTLNGIYQYLINRFPYFKANKRGWQNSIRHNLSLNKCFTKIPRSYDDP- 188
Fly 189 GKGNYWILDPS---AEEVFIGETTGKLRRKNPGASRTRLAAYRQAIFSPMMAASPYGAPA----- 245
Fly 246 -------SSYG----------YPAVPFAAAAAAA 262 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
slp1 | NP_476730.1 | FH | 120..205 | CDD:214627 | 40/88 (45%) |
Foxh1 | NP_032015.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 32..57 | 5/35 (14%) | |
FH | 64..142 | CDD:238016 | 36/77 (47%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 179..251 | 10/50 (20%) | |||
SMAD-interaction domain (SID) | 307..390 | ||||
Fast/FoxH1 motif 1 (FM1) | 311..315 | ||||
Fast/FoxH1 motif 2 (FM2) | 321..327 | ||||
SMAD interaction motif (SIM) | 363..384 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG2294 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1270467at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.820 |