DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp1 and Foxh1

DIOPT Version :9

Sequence 1:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_032015.1 Gene:Foxh1 / 14106 MGIID:1347465 Length:401 Species:Mus musculus


Alignment Length:229 Identity:66/229 - (28%)
Similarity:103/229 - (44%) Gaps:43/229 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 SPSRTSTPMSSAAESLSSQNNDKLDVEFDDELEDQLDEDQESEDGNPSKKQKMTAGSDTKKPPYS 124
            ||.....|.......:..::|.:|           ...:.||....|.:::|.....|  ||||:
Mouse    17 SPQLALAPAQGYLPCMGPRDNSQL-----------RPPEAESLSKTPKRRKKRYLRHD--KPPYT 68

  Fly   125 YNALIMMAIQDSPEQRLTLNGIYQYLINRFPYFKANKRGWQNSIRHNLSLNKCFTKIPRSYDDP- 188
            |.|:|.:.||.:|.:||.|..|.:.:...||:|:.:..||::|||||||.|:||.|:|:....| 
Mouse    69 YLAMIALVIQAAPFRRLKLAQIIRQVQAVFPFFRDDYEGWKDSIRHNLSSNRCFHKVPKDPAKPQ 133

  Fly   189 GKGNYWILDPS---AEEVFIGETTGKLRRKNPGASRTRLAAYRQAIFSPMMAASPYGAPA----- 245
            .|||:|.:|.|   ||.:.:..|....|.:|.|..|    |:.:.:...::...||..|:     
Mouse   134 AKGNFWAVDVSLIPAEALRLQNTALCRRWQNRGTHR----AFAKDLSPYVLHGQPYQPPSPPPPP 194

  Fly   246 -------SSYG----------YPAVPFAAAAAAA 262
                   |..|          :|.:|..:.||.|
Mouse   195 REGFSIKSLLGDPGKESTWPQHPGLPGQSTAAQA 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp1NP_476730.1 FH 120..205 CDD:214627 40/88 (45%)
Foxh1NP_032015.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 32..57 5/35 (14%)
FH 64..142 CDD:238016 36/77 (47%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 179..251 10/50 (20%)
SMAD-interaction domain (SID) 307..390
Fast/FoxH1 motif 1 (FM1) 311..315
Fast/FoxH1 motif 2 (FM2) 321..327
SMAD interaction motif (SIM) 363..384
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.