DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp1 and Foxj1

DIOPT Version :9

Sequence 1:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_446284.2 Gene:Foxj1 / 116557 RGDID:621764 Length:421 Species:Rattus norvegicus


Alignment Length:249 Identity:85/249 - (34%)
Similarity:116/249 - (46%) Gaps:50/249 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SEMEFKSNFSIDAILAKKPINTATQPIKTEPVHHHHQYVHPYSNSDGELSASED--FDSPSRTST 66
            :.:::...|||  :.||.|   ...|..|:| |.:||.  |...:.|...|::.  ...|.....
  Rat    34 TSLQWLQEFSI--LNAKAP---TLPPGGTDP-HGYHQV--PGLVAPGSPLAADPACLGQPHTPGK 90

  Fly    67 PMS-----SAAESLSSQNNDKLDVEFDDELEDQLDEDQESEDGNPSKKQKMTAGSDTKKPPYSYN 126
            |.|     ||...|.:...|  ||::                          |.:...||||||.
  Rat    91 PTSSCTSRSAPPGLQAPPPD--DVDY--------------------------ATNPHVKPPYSYA 127

  Fly   127 ALIMMAIQDSPEQRLTLNGIYQYLINRFPYFKANKRGWQNSIRHNLSLNKCFTKIPRSYDDPGKG 191
            .||.||:|.|...::||:.||:::.:.|.||:.....|||||||||||||||.|:||..|:||||
  Rat   128 TLICMAMQASKATKITLSAIYKWITDNFCYFRHADPTWQNSIRHNLSLNKCFIKVPREKDEPGKG 192

  Fly   192 NYWILDPS-AEEVFIGETTGKLRRKNPGASRTRLAAYRQAIFSPMMAASPYGAP 244
            .:|.:||. ||.:..|  ..|.||..|.......|  |||...|  :.:|:|.|
  Rat   193 GFWRIDPQYAERLLSG--AFKKRRLPPVHIHPAFA--RQAAQEP--STAPWGGP 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp1NP_476730.1 FH 120..205 CDD:214627 47/85 (55%)
Foxj1NP_446284.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..32
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 79..110 6/30 (20%)
FH_FOXJ1 121..199 CDD:410797 43/77 (56%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 256..277
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.