DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp1 and Foxe1

DIOPT Version :9

Sequence 1:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_899121.1 Gene:Foxe1 / 110805 MGIID:1353500 Length:371 Species:Mus musculus


Alignment Length:275 Identity:100/275 - (36%)
Similarity:128/275 - (46%) Gaps:92/275 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 GNPSKKQKMTAGSDTKKPPYSYNALIMMAIQDSPEQRLTLNGIYQYLINRFPYFKANKRGWQNSI 168
            |...:|:.:..|    ||||||.|||.|||..:||:||||.|||:::..|||:::.|.:.|||||
Mouse    43 GGRRRKRPLQRG----KPPYSYIALIAMAIAHAPERRLTLGGIYKFITERFPFYRDNPKKWQNSI 103

  Fly   169 RHNLSLNKCFTKIPRSYDDPGKGNYWILDPSAEEVFIGETTGKLRRKN----------------- 216
            ||||:||.||.||||....|||||||.|||:||::|  |:...|||:.                 
Mouse   104 RHNLTLNDCFLKIPREAGRPGKGNYWALDPNAEDMF--ESGSFLRRRKRFKRSDLSTYPAYMHDA 166

  Fly   217 ------------PGASRTRLAAYRQAIFS----PMMAASPYGAPASSYG----YPAVP------- 254
                        |||......||..|:::    |:.|..|...||:|.|    :..||       
Mouse   167 AAAAAAAAAAIFPGAVPAARPAYPGAVYAGYAPPLAAPPPVYYPAASPGPCRVFGLVPERPLSPD 231

  Fly   255 -------------FAAAAAAA---LYQ--------RMNPAAYQAAYQQMQYQQAPQAHHHQAPHP 295
                         |||||.||   .:|        .:|||||.|||              ..|..
Mouse   232 LGPAPSAAGGSCAFAAAAGAAGTGSFQPAVCTGARPVNPAAYAAAY--------------AGPDG 282

  Fly   296 AQMQGYPQQLNAELF 310
            |    |||..::.||
Mouse   283 A----YPQGASSALF 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp1NP_476730.1 FH 120..205 CDD:214627 54/84 (64%)
Foxe1NP_899121.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 21..53 2/9 (22%)
FH 55..143 CDD:214627 56/89 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.