DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp1 and LOC101730723

DIOPT Version :9

Sequence 1:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster
Sequence 2:XP_031760018.1 Gene:LOC101730723 / 101730723 -ID:- Length:337 Species:Xenopus tropicalis


Alignment Length:233 Identity:73/233 - (31%)
Similarity:106/233 - (45%) Gaps:51/233 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 PSRTSTPMSSAAESLSSQNNDKLDVEFDDELEDQLDEDQESEDGNPSKKQKMTAGSDTKKPPYSY 125
            ||.......:||...:...:.|.|.|...|.:...|.         .||:|..:.....||||||
 Frog    18 PSMEKKSAPAAANRATLPPSPKGDSEGPREPDSSADW---------KKKKKKKSYQRYAKPPYSY 73

  Fly   126 NALIMMAIQDSPEQRLTLNGIYQYLINRFPYFKANKRGWQNSIRHNLSLNKCFTKIPRSYDDP-- 188
            .|:|.:.||:.||:||.|:.|.|.:.:.||:||.|.:||::|||||||.|.||.|:.:   ||  
 Frog    74 LAMIALVIQNCPEKRLKLSQILQDISSLFPFFKGNYQGWKDSIRHNLSSNDCFRKVLK---DPLK 135

  Fly   189 --GKGNYWILDPSAEEVFIGETTGKLRRKNPGASRTR-LAAYRQAIFSPMMAASPYGAPASSYGY 250
              .|||||.:|              :.|..|.|.:.: .|..||.:| |:..     ||...:|.
 Frog   136 PQAKGNYWTVD--------------VTRIPPDALKLQNTAVTRQDLF-PLDL-----APYILHGQ 180

  Fly   251 PAVPFAAAAAAALYQRMNPAAYQAAY--QQMQYQQAPQ 286
            |            |:..:.|.:...:  .:|:.:.|||
 Frog   181 P------------YRERHSANHTREHTTPRMELKVAPQ 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp1NP_476730.1 FH 120..205 CDD:214627 43/88 (49%)
LOC101730723XP_031760018.1 COG5025 66..>322 CDD:227358 61/176 (35%)
FH_FOXH 68..146 CDD:410796 42/80 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.