DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp1 and foxb2

DIOPT Version :9

Sequence 1:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster
Sequence 2:XP_004921500.2 Gene:foxb2 / 101730239 XenbaseID:XB-GENE-1021718 Length:317 Species:Xenopus tropicalis


Alignment Length:209 Identity:74/209 - (35%)
Similarity:98/209 - (46%) Gaps:38/209 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 KKPPYSYNALIMMAIQDSPEQRLTLNGIYQYLINRFPYFKANKRGWQNSIRHNLSLNKCFTKIPR 183
            :||||||.:|..||||.|.|:.|.|:.||:::::||||::.|.:.||||:|||||.|.||.||||
 Frog    12 QKPPYSYISLTAMAIQSSQEKMLPLSDIYKFIMDRFPYYRENTQRWQNSLRHNLSFNDCFIKIPR 76

  Fly   184 SYDDPGKGNYWILDPSAEEVFIGETTGKLRRKNPGASRTRLAAYR---------QAI--FSPMMA 237
            ..|.||||::|.|.|...::|  |....|||      |.|....|         |.|  |.....
 Frog    77 RPDQPGKGSFWALHPDCGDMF--ENGSFLRR------RKRFKVVRAEHLASKSHQMIHYFHHQHN 133

  Fly   238 ASPYGAPASSYGYPAVPFAAAAAAALYQRMNPAAYQAA---------------YQQMQYQQAPQA 287
            .:..|.|||. |.|............|...|.:..|.:               |:.:.....|.|
 Frog   134 QTKLGIPASE-GSPVPSLGRLPHFQPYNIANMSGSQTSGFKHPFAIENIIGRDYKGVMTGGLPLA 197

  Fly   288 ---HHHQAPHPAQM 298
               ||...|.|:|:
 Frog   198 SMMHHLGYPVPSQL 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp1NP_476730.1 FH 120..205 CDD:214627 46/84 (55%)
foxb2XP_004921500.2 FH_FOXB2 1..110 CDD:410817 53/105 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.