DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp1 and foxd2

DIOPT Version :9

Sequence 1:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster
Sequence 2:XP_002931458.1 Gene:foxd2 / 100495241 XenbaseID:XB-GENE-479818 Length:348 Species:Xenopus tropicalis


Alignment Length:271 Identity:91/271 - (33%)
Similarity:120/271 - (44%) Gaps:70/271 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 TPMSSAAESLSSQNNDKLDVEFDDELED----QLDEDQESEDGNPSKKQ------KMTAGSDTK- 119
            |.||.  .||.|::.| :||..|...:|    ....|.:|:|..|...:      .:::||::. 
 Frog     5 TEMSD--NSLLSEDTD-IDVVGDMGAKDGKYSDYHSDNDSDDNGPRTHRGDPASPDLSSGSESNQ 66

  Fly   120 -----------KPPYSYNALIMMAIQDSPEQRLTLNGIYQYLINRFPYFKANKRGWQNSIRHNLS 173
                       ||||||.|||.|||..||::||||:.|.:::.|||||::.....||||||||||
 Frog    67 RAEKPPKNALVKPPYSYIALITMAILQSPKKRLTLSEICEFISNRFPYYREKFPAWQNSIRHNLS 131

  Fly   174 LNKCFTKIPRSYDDPGKGNYWILDPSAEEVFIGETTGKLRRKNPGASRTRLAAYRQAIFSPMMAA 238
            ||.||.||||...:|||||||.|||.:.::|          .|....|.|....||.  |..:..
 Frog   132 LNDCFVKIPREPGNPGKGNYWTLDPESADMF----------DNGSFLRRRKRFKRQQ--SNEILR 184

  Fly   239 SPYGAPASSYGYPAVPFAAAAAAALYQRMNPAAYQAAYQQMQYQQAPQAHHHQA----------- 292
            .|.....:::||                 .|..|....|...|.|    |||..           
 Frog   185 DPSSFMPAAFGY-----------------GPYGYNYGLQLQNYHQ----HHHTGATFSFQPTHCP 228

  Fly   293 -PHPAQMQGYP 302
             |.||.:...|
 Frog   229 LPPPASVFSSP 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp1NP_476730.1 FH 120..205 CDD:214627 52/84 (62%)
foxd2XP_002931458.1 Forkhead 78..163 CDD:365978 53/94 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.050

Return to query results.
Submit another query.