DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp1 and foxe3

DIOPT Version :9

Sequence 1:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster
Sequence 2:XP_002931457.1 Gene:foxe3 / 100495102 XenbaseID:XB-GENE-480592 Length:398 Species:Xenopus tropicalis


Alignment Length:260 Identity:90/260 - (34%)
Similarity:134/260 - (51%) Gaps:39/260 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 PYSNSDGELSASEDFDSPSRTSTPMSSAAESLSSQNNDKLDVE-----FDDELEDQLDEDQESED 103
            ||.:....::|... .||:..::|:.| :.|:.|..:.::..|     ..:|..:.|.::.....
 Frog     7 PYYSGMCTMTADSQ-HSPTEAASPIPS-SPSMDSPGSVRVKCEPKGTCSPEEGVNGLPDEHNQAS 69

  Fly   104 GNPSKKQKMTAGSDTKKPPYSYNALIMMAIQDSPEQRLTLNGIYQYLINRFPYFKANKRGWQNSI 168
            |...:|:.:..|    ||||||.|||.|||.:|||::|||.|||::::.|||:::.|.:.|||||
 Frog    70 GGRRRKRPIQRG----KPPYSYIALIAMAIANSPERKLTLGGIYKFIMERFPFYRENSKKWQNSI 130

  Fly   169 RHNLSLNKCFTKIPRSYDDPGKGNYWILDPSAEEVFIGETTGKLRRKNPGASRTRLAAY-----R 228
            ||||:||.||.||||....|||||||.|||:||::|   ..|...|:.....||.|..|     .
 Frog   131 RHNLTLNDCFVKIPREPGHPGKGNYWTLDPAAEDMF---DNGSFLRRRKRFKRTDLTTYPGYMQN 192

  Fly   229 QAIFSPMMAASPYGAPASSYGYPAVPFAAAAAAALYQRMNPAAYQAAYQQMQYQQAPQAHHHQAP 293
            .:.|:|        .||....||...:::..:.     .||..:|..:..|       .||:|.|
 Frog   193 SSAFTP--------TPAGRASYPTSIYSSVGSG-----YNPQIHQTHHPAM-------VHHYQPP 237

  Fly   294  293
             Frog   238  237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp1NP_476730.1 FH 120..205 CDD:214627 54/84 (64%)
foxe3XP_002931457.1 FH 82..170 CDD:214627 55/90 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.