DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp1 and foxc1a

DIOPT Version :9

Sequence 1:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_571803.1 Gene:foxc1a / 100148408 ZFINID:ZDB-GENE-010302-1 Length:476 Species:Danio rerio


Alignment Length:235 Identity:82/235 - (34%)
Similarity:115/235 - (48%) Gaps:78/235 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 DTKKPPYSYNALIMMAIQDSPEQRLTLNGIYQYLINRFPYFKANKRGWQNSIRHNLSLNKCFTKI 181
            |..||||||.|||.||||:||::::|||||||:::.|||:::.||:|||||||||||||:||.|:
Zfish    71 DMVKPPYSYIALITMAIQNSPDKKVTLNGIYQFIMERFPFYRDNKQGWQNSIRHNLSLNECFVKV 135

  Fly   182 PRSYDDPGKGNYWILDPSAEEVFIGETTGKLRRKN------------------------------ 216
            ||....||||:||.|||.:..:|  |....|||:.                              
Zfish   136 PRDDKKPGKGSYWTLDPDSYNMF--ENGSFLRRRRRFKKKDAMKDKEDRGVKEAPSRQAQPQARE 198

  Fly   217 -----PGASRTRLAAYR---------QAIFSPMMAA-----SPYGAPASSYGYP-AVPFAAAAAA 261
                 ||:...|:...:         ||: ||.::.     ||..:.:.|.|.| ::|...:.: 
Zfish   199 QEQSVPGSQPVRIQDIKTENGTSTPPQAV-SPTLSTVPKIESPDSSSSMSSGSPHSIPSTRSLS- 261

  Fly   262 ALYQRMNPAAYQAAYQQMQYQQAPQAHHHQAPHPAQMQGY 301
                 ::.|..|               |||||    .||:
Zfish   262 -----LDSAGEQ---------------HHQAP----AQGF 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp1NP_476730.1 FH 120..205 CDD:214627 54/84 (64%)
foxc1aNP_571803.1 Forkhead 74..160 CDD:278670 55/87 (63%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 169..271 16/123 (13%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 284..303
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.