Sequence 1: | NP_476730.1 | Gene: | slp1 / 33607 | FlyBaseID: | FBgn0003430 | Length: | 322 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_571803.1 | Gene: | foxc1a / 100148408 | ZFINID: | ZDB-GENE-010302-1 | Length: | 476 | Species: | Danio rerio |
Alignment Length: | 235 | Identity: | 82/235 - (34%) |
---|---|---|---|
Similarity: | 115/235 - (48%) | Gaps: | 78/235 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 117 DTKKPPYSYNALIMMAIQDSPEQRLTLNGIYQYLINRFPYFKANKRGWQNSIRHNLSLNKCFTKI 181
Fly 182 PRSYDDPGKGNYWILDPSAEEVFIGETTGKLRRKN------------------------------ 216
Fly 217 -----PGASRTRLAAYR---------QAIFSPMMAA-----SPYGAPASSYGYP-AVPFAAAAAA 261
Fly 262 ALYQRMNPAAYQAAYQQMQYQQAPQAHHHQAPHPAQMQGY 301 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
slp1 | NP_476730.1 | FH | 120..205 | CDD:214627 | 54/84 (64%) |
foxc1a | NP_571803.1 | Forkhead | 74..160 | CDD:278670 | 55/87 (63%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 169..271 | 16/123 (13%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 284..303 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG2294 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1270467at2759 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0000010 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.820 |