DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp1 and foxg1

DIOPT Version :9

Sequence 1:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001116933.1 Gene:foxg1 / 100144706 XenbaseID:XB-GENE-480076 Length:432 Species:Xenopus tropicalis


Alignment Length:299 Identity:118/299 - (39%)
Similarity:168/299 - (56%) Gaps:31/299 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KSNFSIDAILAKKPINTATQPIKTEPVHHHHQYV------HPYSNSDGELSASEDFDSPSRTSTP 67
            ||:|||:: |..:.:.....|   :|.||||.::      |........|...::.|     .:.
 Frog    12 KSSFSINS-LVPEAVQNDNHP---QPHHHHHHHLQLPQQSHHLQPHHRPLQEEDELD-----KSL 67

  Fly    68 MSSAAESLSSQNNDKLDVEFDDELEDQLDEDQESEDGNPSKKQKMTAGSDTK-----KPPYSYNA 127
            :....|||.....|....|...| :.:..||::::.|.....:....|.:.|     |||:||||
 Frog    68 LEVKTESLPPGKGDPAASELPGE-DKEKSEDKKADGGGGKDGENGKEGGEKKNGKYEKPPFSYNA 131

  Fly   128 LIMMAIQDSPEQRLTLNGIYQYLINRFPYFKANKRGWQNSIRHNLSLNKCFTKIPRSYDDPGKGN 192
            ||||||:.|||:||||||||::::..|||::.||:||||||||||||||||.|:||.||||||||
 Frog   132 LIMMAIRQSPEKRLTLNGIYEFIMKNFPYYRENKQGWQNSIRHNLSLNKCFVKVPRHYDDPGKGN 196

  Fly   193 YWILDPSAEEVFIGETTGKLRRKNPGASRTRLAAYRQAIFSPMMAASPYGAPASSYGYPAVPFAA 257
            ||:||||:::||||.|||||||::. .||.:||..|.|..:  .....:...|.|..:|..||.:
 Frog   197 YWMLDPSSDDVFIGGTTGKLRRRST-TSRAKLAFKRGARLT--STGLTFMDRAGSLYWPMSPFLS 258

  Fly   258 ----AAAAALYQRMNPAAYQA---AYQQMQYQQAPQAHH 289
                .|::||......:||.:   .|..:..|.:..::|
 Frog   259 LHHPRASSALSYNGTTSAYPSHPMPYSSVLTQNSLGSNH 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp1NP_476730.1 FH 120..205 CDD:214627 63/84 (75%)
foxg1NP_001116933.1 FH 124..212 CDD:214627 66/87 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 1 1.000 - - otm49365
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1751
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.