DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp1 and foxj3

DIOPT Version :9

Sequence 1:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001103516.1 Gene:foxj3 / 100126207 XenbaseID:XB-GENE-481185 Length:603 Species:Xenopus tropicalis


Alignment Length:371 Identity:93/371 - (25%)
Similarity:127/371 - (34%) Gaps:175/371 - (47%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 DQLDEDQESEDGNPSKKQKMTAGSDTKKPPYSYNALIMMAIQDSPEQRLTLNGIYQYLINRFPYF 157
            || :|.|:.:||               ||||||.:||..||..||::::||:.|||::.:.|||:
 Frog    52 DQ-EEVQQHKDG---------------KPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYY 100

  Fly   158 KANKRGWQNSIRHNLSLNKCFTKIPRSYDDPGKGNYWILD---------------PSAEE----- 202
            |....||:|||||||||||||.|:|||.||||||:||.:|               |.:||     
 Frog   101 KEAGSGWKNSIRHNLSLNKCFLKVPRSKDDPGKGSYWAIDTNPKEDAAQARPRKRPRSEERASTP 165

  Fly   203 ---------------------VFIGETTGK-----------------------------LRRKNP 217
                                 :.|...|.|                             |...|.
 Frog   166 YSIDSDSLGMDCIIPGSASPNLAINTVTNKVTLYNTDQDGNDSPRSSLNNSLSDQSVSSLNLNNV 230

  Fly   218 GA--SRTRLAAYRQAIFSPMMAASPYGAPASSYGYPAVPF--AAAAAAALY-------------- 264
            |:  |.|.:.::.:.....:...|||.||.....:|...|  .:.:..:||              
 Frog   231 GSVHSYTSVTSHPEPSAQTLTQQSPYSAPERDKLFPEYNFEDLSDSFRSLYKSVFEHSVSQGLMN 295

  Fly   265 -------QRMNPAAYQ------AAYQQ-----------------------------------MQY 281
                   |..:|.:||      .:.||                                   .|.
 Frog   296 LPSESSQQTHSPCSYQHSPSSTMSSQQHSSQNNITNSHASNLGTNVGDSMGQVHLSHTQLHTQQS 360

  Fly   282 QQAPQAHH-----------------------HQAPHPAQMQGYPQQ 304
            |.:|..||                       ||..||.|...:|.|
 Frog   361 QHSPHIHHNVVHHQHPQQCTQHTSHCHQQSPHQPQHPQQRAQHPAQ 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp1NP_476730.1 FH 120..205 CDD:214627 52/125 (42%)
foxj3NP_001103516.1 FH_FOXJ3 62..140 CDD:410826 49/92 (53%)
COG5025 <63..329 CDD:227358 75/265 (28%)
KLF1_2_4_N <342..419 CDD:425360 12/65 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.