DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp1 and foxf2

DIOPT Version :9

Sequence 1:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001093702.1 Gene:foxf2 / 100101712 XenbaseID:XB-GENE-484646 Length:381 Species:Xenopus tropicalis


Alignment Length:360 Identity:97/360 - (26%)
Similarity:144/360 - (40%) Gaps:125/360 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 SPSRTSTPMSSAAESLSSQNNDKLDVEFDDELEDQLDEDQESEDGNPSKKQKMTAG-SDTKKPPY 123
            :|.||:....:...:|.||.:..:|.              .|...:.||.:|..:| ...:||||
 Frog    15 APIRTNPATGTLQSALMSQQSTAMDT--------------TSSSSSSSKNKKPNSGLRRPEKPPY 65

  Fly   124 SYNALIMMAIQDSPEQRLTLNGIYQYLINRFPYFKANKRGWQNSIRHNLSLNKCFTKIPRSYDDP 188
            ||.|||:||||.||.:||||:.|||:|..|||:|:.:.:||:||:|||||||:||.|:|:....|
 Frog    66 SYIALIVMAIQSSPTKRLTLSEIYQFLQARFPFFRGSYQGWKNSVRHNLSLNECFIKLPKGLGRP 130

  Fly   189 GKGNYWILDPSAEEVFIGETTGKLRRK-------------------------------------- 215
            |||:||.:||::|.:|   ..|..||:                                      
 Frog   131 GKGHYWTIDPASEFMF---EEGSFRRRPRGFRRKCQALKPMYRMMNGIGFSTSILPQGFDFQAPP 192

  Fly   216 -------------------------------------NPGASRTRLAAYRQAIFSPMMAASPYGA 243
                                                 |||:  |.:|:      .|:.::..||.
 Frog   193 ASLTCHSNGYNLDMMSNSMAGGYDGLAGGHHVPHMSPNPGS--TYMAS------CPVSSSGDYGP 249

  Fly   244 PASSYGYPAVPFAAAAAAALYQRMNPAAYQAAYQQMQY-QQAP---------------------Q 286
            .:||...|:.|..|:|........:|.|:.|:.....| :|.|                     |
 Frog   250 DSSSSPVPSSPAMASAMECHSPYTSPTAHWASSGASPYLKQQPMPPSNGASAGIHTGVSPYSLEQ 314

  Fly   287 AHHHQAPHPAQMQGYP--QQLNAELFQRMQFFGKF 319
            ::.||.|......|.|  |..::.:..|..|...|
 Frog   315 SYLHQNPREDLSVGLPRYQHHSSPVCDRKDFVLNF 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp1NP_476730.1 FH 120..205 CDD:214627 51/84 (61%)
foxf2NP_001093702.1 Forkhead 61..147 CDD:365978 52/88 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.