DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp1 and foxl1

DIOPT Version :9

Sequence 1:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster
Sequence 2:XP_012817795.1 Gene:foxl1 / 100038263 XenbaseID:XB-GENE-5880620 Length:406 Species:Xenopus tropicalis


Alignment Length:97 Identity:59/97 - (60%)
Similarity:75/97 - (77%) Gaps:3/97 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 KKPPYSYNALIMMAIQDSPEQRLTLNGIYQYLINRFPYFKANKRGWQNSIRHNLSLNKCFTKIPR 183
            :||||||.|||.|||:|||:.|:|||||||::::|||::..||:|||||||||||||.||.|:||
 Frog    50 QKPPYSYIALIAMAIKDSPDHRVTLNGIYQFIMDRFPFYHDNKQGWQNSIRHNLSLNDCFIKVPR 114

  Fly   184 SYDDPGKGNYWILDPSAEEVFIGETTGKLRRK 215
            ....||||:||.|||...::|   ..|..||:
 Frog   115 EKGRPGKGSYWTLDPKCLDMF---ENGNFRRR 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp1NP_476730.1 FH 120..205 CDD:214627 55/84 (65%)
foxl1XP_012817795.1 Forkhead 50..136 CDD:365978 56/88 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.