DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp1 and foxe1

DIOPT Version :9

Sequence 1:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster
Sequence 2:XP_002936729.1 Gene:foxe1 / 100038190 XenbaseID:XB-GENE-478544 Length:377 Species:Xenopus tropicalis


Alignment Length:350 Identity:103/350 - (29%)
Similarity:150/350 - (42%) Gaps:102/350 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 SEDFDSPSRTSTPMSSAAESLSSQNNDKLDVEFDDELEDQLDE-DQESEDGNPSKKQK--MTAGS 116
            :|:..||:| :|...::.:..|......:.||.|...|..:.. ..|.||....:::|  :..| 
 Frog     3 AENQQSPTR-ATAAGASLQQASGLTMPVVKVEKDPAPEASMSNGGSEGEDTPKGRRRKRPLQKG- 65

  Fly   117 DTKKPPYSYNALIMMAIQDSPEQRLTLNGIYQYLINRFPYFKANKRGWQNSIRHNLSLNKCFTKI 181
               ||||||.|||.|||.:|.:::|||.|||:::..|||:::.|.:.|||||||||:||.||.||
 Frog    66 ---KPPYSYIALIAMAIANSTDRKLTLGGIYKFITERFPFYRDNSKKWQNSIRHNLTLNDCFIKI 127

  Fly   182 PRSYDDPGKGNYWILDPSAEEVFIGETTGKLRRKNPGASRTRLAAY-----RQAIFSPM------ 235
            ||....|||||||.|||:||::|   .:|...|:.....||.|..|     ..::|||:      
 Frog   128 PREPGRPGKGNYWALDPNAEDMF---DSGSFLRRRKRFKRTDLTTYPAYIHDTSMFSPLQVARAT 189

  Fly   236 --------MAASP-YG---APASSYGYPAVPFA-------------------------------- 256
                    |..|| |.   ||.||..||:...|                                
 Frog   190 YPNTVYPNMTMSPSYSQQIAPHSSVYYPSSSPAFSSAQPRVFSINTLIGHSGSEHAQQPNRSISP 254

  Fly   257 --------------------AAAAAALYQRMNPAAYQAAYQQMQYQQAPQAHHHQAPHPAQMQGY 301
                                |.:...|.:..||.:|......:|..|:...|.:     ||:.|.
 Frog   255 EVNSTSSSSCNYGGSTYSSQAGSGTMLPRSTNPYSYSVPNSHLQMNQSSYPHSN-----AQLFGS 314

  Fly   302 PQQL--------NAELFQRMQFFGK 318
            ..:|        |::   .:.|:|:
 Frog   315 ASRLPMPTSPPMNSD---AVDFYGR 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp1NP_476730.1 FH 120..205 CDD:214627 52/84 (62%)
foxe1XP_002936729.1 FH 66..154 CDD:214627 53/90 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.