DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp1 and foxd7

DIOPT Version :9

Sequence 1:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001082957.1 Gene:foxd7 / 100037333 ZFINID:ZDB-GENE-070410-88 Length:308 Species:Danio rerio


Alignment Length:265 Identity:88/265 - (33%)
Similarity:129/265 - (48%) Gaps:52/265 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 DELEDQLDEDQESEDGNPSKKQKMTAGSDTKKPPYSYNALIMMAIQDSPEQRLTLNGIYQYLINR 153
            |::.::.:|:.......||...|    |.:.||||||.|||.|||..||::||||:.|..::.:|
Zfish    37 DQVHNKDEENHVPSSICPSSSSK----SSSVKPPYSYIALITMAILQSPKKRLTLSEICDFISHR 97

  Fly   154 FPYFKANKRGWQNSIRHNLSLNKCFTKIPRSYDDPGKGNYWILDPSAEEVFIGETTGKLRRKNPG 218
            |.|::.....||||||||||||.||.|:||...:|||||||.|||::.::|  |....|||:   
Zfish    98 FVYYREKFPAWQNSIRHNLSLNDCFVKMPREPGNPGKGNYWTLDPNSSDMF--ENGSFLRRR--- 157

  Fly   219 ASRTRLAAYRQAIFSPMMAASPYGAPASSYG----------------YP-------AVPFAAA-- 258
             .|.:...::..:|.. .|..|.|.|..|||                ||       .||...:  
Zfish   158 -KRFKRQHFKFGVFKD-QALQPSGFPNLSYGAYGLSASCAHLPALDVYPYSFHQHIGVPPVGSIL 220

  Fly   259 -AAAALYQRMNPAAYQAAYQQMQ------------YQQAPQAHHHQAPHPAQMQGYPQQLNAEL- 309
             |.:.|:.|.:.||  .::.|.|            ...||.:.:..:.......|:|:.||.:. 
Zfish   221 PALSTLFSRNSVAA--KSFPQSQTVAIEPVTPGIACAMAPTSPYASSAALFNPVGFPRMLNFQYE 283

  Fly   310 FQRMQ 314
            :|::|
Zfish   284 YQKLQ 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp1NP_476730.1 FH 120..205 CDD:214627 49/84 (58%)
foxd7NP_001082957.1 Forkhead 67..150 CDD:278670 47/84 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.