DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment slp1 and foxl2l

DIOPT Version :9

Sequence 1:NP_476730.1 Gene:slp1 / 33607 FlyBaseID:FBgn0003430 Length:322 Species:Drosophila melanogaster
Sequence 2:NP_001122282.1 Gene:foxl2l / 100004081 ZFINID:ZDB-GENE-081022-71 Length:260 Species:Danio rerio


Alignment Length:212 Identity:78/212 - (36%)
Similarity:104/212 - (49%) Gaps:51/212 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 DDELEDQLDEDQESEDGNPSKKQKMTAGSDTKKPPYSYNALIMMAIQDSPEQRLTLNGIYQYLIN 152
            |.:..|...||.....|.|.      |....:||||||.|||.|||::|.:::||||.||.|:|:
Zfish     9 DLQCRDAAVEDCSETAGCPG------AAPAPEKPPYSYVALIAMAIRESEDKKLTLNDIYSYIIS 67

  Fly   153 RFPYFKANKRGWQNSIRHNLSLNKCFTKIPRSYDDPGKGNYWILDPSAEEVFIGETTGKLRRKNP 217
            :|||::.||:|||||||||||||:||.||||......|||:|.|||:..::|   ..|..||   
Zfish    68 KFPYYEKNKKGWQNSIRHNLSLNECFVKIPRESGGERKGNFWTLDPAFNDMF---EKGNYRR--- 126

  Fly   218 GASRTRLAAYRQAIFSPMMAASPYGAPASSYGYPAVPFAAAAAAALYQRMNPAAYQAAYQQMQYQ 282
               |.|:..                           |:..||..:.|...:|...|   |:..|.
Zfish   127 ---RRRVKR---------------------------PYRPAALPSGYNFADPYCLQ---QEPVYW 158

  Fly   283 QAP------QAHHHQAP 293
            |:|      .:||..:|
Zfish   159 QSPFVSSGSWSHHSGSP 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
slp1NP_476730.1 FH 120..205 CDD:214627 52/84 (62%)
foxl2lNP_001122282.1 Forkhead 35..121 CDD:278670 53/88 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170574871
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.