DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3407 and CG17359

DIOPT Version :9

Sequence 1:NP_608809.1 Gene:CG3407 / 33606 FlyBaseID:FBgn0031573 Length:714 Species:Drosophila melanogaster
Sequence 2:NP_648679.1 Gene:CG17359 / 39549 FlyBaseID:FBgn0036396 Length:339 Species:Drosophila melanogaster


Alignment Length:535 Identity:105/535 - (19%)
Similarity:163/535 - (30%) Gaps:230/535 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 CEICGYAVHTQLDFFAHLKQHYEPTVLEQRLVVQDPQQQHQQKEPLDMCGLSAQD---------- 222
            |.:|.......||.:.      ||.....|:..|:|......:| ...|.:..:|          
  Fly     7 CRVCRDESDCLLDIYT------EPYASSNRVQEQEPVLATMLRE-CSGCSVHKEDGMPQFICVEC 64

  Fly   223 --------KLQQEQAKLDQVFQDVQLNFENFHNISHHVNDVANVGVNMVLHGQATDKLNAVVVNT 279
                    :|:::..|..|.|:.::|..:...:|.:    ..|:|.|:      ..::...|:..
  Fly    65 AEAVRNAYRLRRQCRKSHQYFEQLRLMMKELDDIEY----CLNIGDNI------EPQMPVSVMEA 119

  Fly   280 SSTPNSVPVVDDVEFSDTEDMLEGIRNVVDKVSIEDTCDELVDLELTSSGMTAPWFNNNFRDITF 344
            ..||.:           :|.:|.                |||.::                    
  Fly   120 GKTPET-----------SEPLLV----------------ELVQVK-------------------- 137

  Fly   345 PALLLPGEPPPASSEPATPLLKENPHVGDHMALDFLSPEKADPQEEAKLEKTLSKACEPNEQTLL 409
               .:|.||.|.||    ||...|.|                     ||.::.|           
  Fly   138 ---YMPPEPKPISS----PLPDNNEH---------------------KLAQSYS----------- 163

  Fly   410 VAPPACQTPPIPTVPPANSSIEQLRRSPLELSEAFKLEEDDMTDSRPASSFEEGD---PDAEEPN 471
                       |...|.|.|                        .|.|.|:.:.|   ||:|..:
  Fly   164 -----------PAKTPHNKS------------------------KRRARSYSDNDSWSPDSELEH 193

  Fly   472 ECFQMEVLDTSLTEEAENKTRRK-----HFCDKCNRDFNSYNALKYHQYTHNQERSHKCDSCERS 531
            |       |......|..:.:.|     :.|..|.:.|.....|:.|...|..||.:||..|.||
  Fly   194 E-------DDDKIWNASKRGKPKRVPGPYRCKLCTQSFTQKQNLEIHMRIHTGERPYKCSLCPRS 251

  Fly   532 FYTQSALKAHERTHSGVKPFKCDKCEFQFRQWGDLKYHIISRHSDVKAHMCEFCGKSFSRRYSLV 596
            |..:..|::|.|.|:|.:||.|..|..:|||.|.|                              
  Fly   252 FAQKGNLQSHTRCHTGERPFGCPNCPKRFRQVGQL------------------------------ 286

  Fly   597 VHRRIHTREKNYACQYCDKTFRASSYLLSHIKVHTGERPYECSICEKKFRVSGDLKRHSRIH--D 659
               ::|||                        .||||:|::||.|::.|:....|::|...|  .
  Fly   287 ---QVHTR------------------------THTGEQPFKCSKCQQSFKQLNGLQKHMSAHTRG 324

  Fly   660 PSRTSQPPAEKAKKK 674
            ..|||....::.|.|
  Fly   325 KRRTSSQETKRNKFK 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3407NP_608809.1 COG5048 <494..656 CDD:227381 43/166 (26%)
C2H2 Zn finger 497..517 CDD:275368 5/19 (26%)
zf-H2C2_2 509..534 CDD:290200 11/24 (46%)
C2H2 Zn finger 525..545 CDD:275368 8/19 (42%)
zf-H2C2_2 537..562 CDD:290200 10/24 (42%)
C2H2 Zn finger 555..574 CDD:275371 6/18 (33%)
zf-C2H2 580..602 CDD:278523 0/21 (0%)
C2H2 Zn finger 582..602 CDD:275368 0/19 (0%)
zf-H2C2_2 594..617 CDD:290200 3/22 (14%)
C2H2 Zn finger 610..630 CDD:275368 0/19 (0%)
zf-H2C2_2 622..645 CDD:290200 8/22 (36%)
zf-C2H2 636..658 CDD:278523 6/21 (29%)
C2H2 Zn finger 638..658 CDD:275368 6/19 (32%)
CG17359NP_648679.1 zf-AD 6..88 CDD:285071 16/87 (18%)
zf-C2H2 215..237 CDD:278523 5/21 (24%)
C2H2 Zn finger 217..237 CDD:275368 5/19 (26%)
zf-H2C2_2 229..254 CDD:290200 11/24 (46%)
C2H2 Zn finger 245..265 CDD:275368 8/19 (42%)
zf-H2C2_2 257..282 CDD:290200 10/24 (42%)
C2H2 Zn finger 273..293 CDD:275368 10/76 (13%)
zf-H2C2_2 286..310 CDD:290200 13/80 (16%)
C2H2 Zn finger 301..321 CDD:275368 6/19 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.