DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3407 and Kr

DIOPT Version :9

Sequence 1:NP_608809.1 Gene:CG3407 / 33606 FlyBaseID:FBgn0031573 Length:714 Species:Drosophila melanogaster
Sequence 2:NP_001261181.1 Gene:Kr / 38012 FlyBaseID:FBgn0001325 Length:502 Species:Drosophila melanogaster


Alignment Length:448 Identity:118/448 - (26%)
Similarity:168/448 - (37%) Gaps:138/448 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   353 PPPASSEPATPLLKENPHVGDHM-----ALDFLSPEK---ADPQEEAKLEK----TLSKACEPNE 405
            ||.:::..||......|.:|...     |...|||.:   |:.|..|.:.:    ||:....|:.
  Fly    36 PPMSANTSATSAAAIYPAMGLQQAAAASAFGMLSPTQLLAANRQAAAFMAQLPMSTLANTLFPHN 100

  Fly   406 QTLLVAPPACQ--TPPIPT---VPPANSSIEQLRRSPLELSEAFKLEEDDMTDSRPASSFEEGDP 465
            ...|....|.|  .||..|   .|||:.      .|||               |.|..|   |..
  Fly   101 PAALFGAWAAQQSLPPQGTHLHSPPASP------HSPL---------------STPLGS---GKH 141

  Fly   466 DAEEPNECFQMEVLDTSLTEEAENKTR----RKHFCDKCNRDFNSYNALKYH------------- 513
            ....||        .|....|...|.|    :|.|..:.:...|.    .||             
  Fly   142 PLNSPN--------STPQHHEPAKKARKLSVKKEFQTEISMSVND----MYHTSGGPISPPSSGS 194

  Fly   514 --QYTH----------------NQERSHKCDSCERSFYTQSALKAHERTHSGVKPFKCDKCEFQF 560
              ..||                ::::|..|..|.|||..:..|:.|||||:|.|||:|.:|..:|
  Fly   195 SPNSTHDGAGGNAGCVGVSKDPSRDKSFTCKICSRSFGYKHVLQNHERTHTGEKPFECPECHKRF 259

  Fly   561 RQWGDLKYHIISRHSDVKAHMCEFCGKSFSRRYSLVVHRRIHTREKNYACQYCDKTFRASSYLLS 625
            .:...||.| :..|:..|.:.|..|.:.|.:..:|..|.|:||.|:.|.|:.||..|..|:.|.|
  Fly   260 TRDHHLKTH-MRLHTGEKPYHCSHCDRQFVQVANLRRHLRVHTGERPYTCEICDGKFSDSNQLKS 323

  Fly   626 HIKVHTGERPYECSICEKKFRVSGDLKRHSRIHDPSRTSQPP-------------------AEKA 671
            |:.||.||:|:||..|..|||     :||..::.......||                   |.:|
  Fly   324 HMLVHNGEKPFECERCHMKFR-----RRHHLMNHKCGIQSPPTPALSPAMSGDYPVAISAIAIEA 383

  Fly   672 KKKRAAA-------SNKQLPIE----EDD---ELA-----------TNIQNNKSDAMR 704
            ...|.||       ||:.:.:|    |||   :|:           :||...|:..:|
  Fly   384 STNRFAAMCATYGGSNESVDMEKATPEDDGPLDLSEDGASSVDGHCSNIARRKAQDIR 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3407NP_608809.1 COG5048 <494..656 CDD:227381 62/192 (32%)
C2H2 Zn finger 497..517 CDD:275368 3/34 (9%)
zf-H2C2_2 509..534 CDD:290200 10/55 (18%)
C2H2 Zn finger 525..545 CDD:275368 9/19 (47%)
zf-H2C2_2 537..562 CDD:290200 13/24 (54%)
C2H2 Zn finger 555..574 CDD:275371 5/18 (28%)
zf-C2H2 580..602 CDD:278523 6/21 (29%)
C2H2 Zn finger 582..602 CDD:275368 6/19 (32%)
zf-H2C2_2 594..617 CDD:290200 10/22 (45%)
C2H2 Zn finger 610..630 CDD:275368 8/19 (42%)
zf-H2C2_2 622..645 CDD:290200 11/22 (50%)
zf-C2H2 636..658 CDD:278523 8/21 (38%)
C2H2 Zn finger 638..658 CDD:275368 7/19 (37%)
KrNP_001261181.1 C2H2 Zn finger 224..244 CDD:275368 9/19 (47%)
zf-H2C2_2 237..261 CDD:290200 13/23 (57%)
C2H2 Zn finger 252..272 CDD:275368 6/20 (30%)
zf-H2C2_2 264..289 CDD:290200 8/25 (32%)
C2H2 Zn finger 280..300 CDD:275368 6/19 (32%)
zf-H2C2_2 292..316 CDD:290200 10/23 (43%)
C2H2 Zn finger 308..328 CDD:275368 8/19 (42%)
zf-H2C2_2 321..345 CDD:290200 14/28 (50%)
C2H2 Zn finger 336..352 CDD:275368 7/20 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.