DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment bark and LOXL3

DIOPT Version :9

Sequence 1:	NP_001245864.1	Gene:	bark / 33604	FlyBaseID:	FBgn0031571	Length:	3123	Species:	Drosophila melanogaster
Sequence 2:	NP_115992.1	Gene:	LOXL3 / 84695	HGNCID:	13869	Length:	753	Species:	Homo sapiens

Alignment Length:	121	Identity:	44/121 - (36%)
Similarity:	61/121 - (50%)	Gaps:	13/121 - (10%)

- Green bases have known domain annotations that are detailed below.

  Fly  1071 VRLVGGAGANEGRLQVYLKGRWGTVCDYGWNVLNAALVCHQLGYSLNPQDWRLLRSQLPNAGTSE 1135
            |||.|||...|||::|.....||||||..|::..|::||.:||:.       ..|..|..|...:
Human   307 VRLKGGAHPGEGRVEVLKASTWGTVCDRKWDLHAASVVCRELGFG-------SAREALSGARMGQ 364

  Fly  1136 D---ILMANVRCTLQDRDVTKCRAEYEFENTCSHENDVGLRC---YEGAWAGVRFS 1185
            .   |.::.|||:.|:..:.||..:......|||..|.|:||   |.||...:|.|
Human   365 GMGAIHLSEVRCSGQELSLWKCPHKNITAEDCSHSQDAGVRCNLPYTGAETRIRLS 420

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
bark	NP_001245864.1	SR	191..295	CDD:214555
		SRCR	196..294	CDD:278931
		CUB	459..552	CDD:238001
		Beta_helix	579..752	CDD:289971
		SR	1071..1175	CDD:214555	39/109 (36%)
		SRCR	1076..1174	CDD:278931	33/100 (33%)
		SR	1932..2037	CDD:214555
		SRCR	1932..2037	CDD:278931
		CLECT	2604..2699	CDD:214480
LOXL3	NP_115992.1	SR	45..144	CDD:214555
		SR	184..281	CDD:214555
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	290..315		6/7 (86%)
		SR	307..407	CDD:214555	38/106 (36%)
		SR	417..525	CDD:214555	2/4 (50%)
		Lysyl-oxidase like	529..732
		Lysyl_oxidase	530..728	CDD:307371
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	1	0.950	-	0	Normalized mean entropy	S6743
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.950