Sequence 1: | NP_001245864.1 | Gene: | bark / 33604 | FlyBaseID: | FBgn0031571 | Length: | 3123 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_648288.2 | Gene: | teq / 39048 | FlyBaseID: | FBgn0023479 | Length: | 2792 | Species: | Drosophila melanogaster |
Alignment Length: | 214 | Identity: | 56/214 - (26%) |
---|---|---|---|
Similarity: | 84/214 - (39%) | Gaps: | 41/214 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 1048 DSETEAIDMETEVIPADGVPRVPVRLVGGAGANEGRLQVYLKGRWGTVCDYGWNVLNAALVCHQL 1112
Fly 1113 GYSLNPQDWRLLRSQLPNAGTSEDILMANVRCTLQDRDVTKCRAEYEFENTCSHENDVGLRCYEG 1177
Fly 1178 -AWAGVRFSM----------------------LAERADLQYVTVEKAGLF--DYTTNAFKPAVQM 1217
Fly 1218 DHARHNLENVRIVNNLQDG 1236 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
bark | NP_001245864.1 | SR | 191..295 | CDD:214555 | |
SRCR | 196..294 | CDD:278931 | |||
CUB | 459..552 | CDD:238001 | |||
Beta_helix | 579..752 | CDD:289971 | |||
SR | 1071..1175 | CDD:214555 | 32/103 (31%) | ||
SRCR | 1076..1174 | CDD:278931 | 29/97 (30%) | ||
SR | 1932..2037 | CDD:214555 | |||
SRCR | 1932..2037 | CDD:278931 | |||
CLECT | 2604..2699 | CDD:214480 | |||
teq | NP_648288.2 | CBM_14 | 65..115 | CDD:279884 | |
ChtBD2 | 136..184 | CDD:214696 | |||
ChtBD2 | 215..261 | CDD:214696 | |||
ChtBD2 | 284..327 | CDD:214696 | |||
CBM_14 | 521..569 | CDD:279884 | |||
ChtBD2 | 608..654 | CDD:214696 | |||
ChtBD2 | 709..752 | CDD:214696 | |||
CBM_14 | 782..830 | CDD:279884 | |||
ChtBD2 | 864..909 | CDD:214696 | |||
CBM_14 | 942..993 | CDD:279884 | |||
RCR | <1051..1126 | CDD:304939 | |||
RCR | <1116..1210 | CDD:304939 | |||
ChtBD2 | 1324..1369 | CDD:214696 | |||
ChtBD2 | 1474..1518 | CDD:214696 | |||
LDLa | 2193..2222 | CDD:238060 | |||
SR | 2229..2331 | CDD:214555 | |||
SRCR | 2234..2332 | CDD:278931 | |||
LDLa | 2337..2370 | CDD:197566 | 2/10 (20%) | ||
SR | 2382..2480 | CDD:214555 | 32/102 (31%) | ||
SRCR | 2386..2480 | CDD:278931 | 29/98 (30%) | ||
Tryp_SPc | 2546..2781 | CDD:214473 | 4/11 (36%) | ||
Tryp_SPc | 2547..2784 | CDD:238113 | 4/10 (40%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 1 | 0.950 | - | 0 | Normalized mean entropy | S6743 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.950 |