Sequence 1: | NP_001245864.1 | Gene: | bark / 33604 | FlyBaseID: | FBgn0031571 | Length: | 3123 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_523806.2 | Gene: | Loxl2 / 37485 | FlyBaseID: | FBgn0034660 | Length: | 511 | Species: | Drosophila melanogaster |
Alignment Length: | 223 | Identity: | 57/223 - (25%) |
---|---|---|---|
Similarity: | 89/223 - (39%) | Gaps: | 46/223 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 1071 VRLVGGAGANEGRLQVYLKGRWGTVCDYGWNVLNAALVCHQLGYSLNPQDWRLLRSQLPNAGTSE 1135
Fly 1136 DILMANVRCTLQDRDVTKCRAEYEFENTCSHENDVGLRCY--EGAWAGVRFSMLAERADLQYVTV 1198
Fly 1199 EKAGLFDYTTNAFKPAVQMDHARHNLENVRIVNNLQDG---------------------LGIIYA 1242
Fly 1243 ------DIYAGKSVNN--IKNSEFSGNK 1262 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
bark | NP_001245864.1 | SR | 191..295 | CDD:214555 | |
SRCR | 196..294 | CDD:278931 | |||
CUB | 459..552 | CDD:238001 | |||
Beta_helix | 579..752 | CDD:289971 | |||
SR | 1071..1175 | CDD:214555 | 34/103 (33%) | ||
SRCR | 1076..1174 | CDD:278931 | 30/97 (31%) | ||
SR | 1932..2037 | CDD:214555 | |||
SRCR | 1932..2037 | CDD:278931 | |||
CLECT | 2604..2699 | CDD:214480 | |||
Loxl2 | NP_523806.2 | SR | 61..161 | CDD:214555 | 34/103 (33%) |
SRCR | 66..160 | CDD:278931 | 30/97 (31%) | ||
SR | 193..298 | CDD:214555 | 17/77 (22%) | ||
SRCR | 198..298 | CDD:278931 | 16/72 (22%) | ||
Lysyl_oxidase | 303..503 | CDD:279521 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 1 | 0.950 | - | 0 | Normalized mean entropy | S6743 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.950 |