DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bark and Loxl2

DIOPT Version :9

Sequence 1:NP_001245864.1 Gene:bark / 33604 FlyBaseID:FBgn0031571 Length:3123 Species:Drosophila melanogaster
Sequence 2:NP_523806.2 Gene:Loxl2 / 37485 FlyBaseID:FBgn0034660 Length:511 Species:Drosophila melanogaster


Alignment Length:223 Identity:57/223 - (25%)
Similarity:89/223 - (39%) Gaps:46/223 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly  1071 VRLVGGAGANEGRLQVYLKGRWGTVCDYGWNVLNAALVCHQLGYSLNPQDWRLLRSQLPNAGTSE 1135
            :|||||....||.::|...|:||.|||..|:...|.:||.|||:   |...|..||.........
  Fly    61 IRLVGGDNEYEGNIEVLHNGKWGAVCDDEWDSTEADIVCRQLGF---PGMRRYTRSGFFGPARRR 122

  Fly  1136 DILMANVRCTLQDRDVTKCRAEYEFENTCSHENDVGLRCY--EGAWAGVRFSMLAERADLQYVTV 1198
             ..|.|:.|...::::..|..|...||.|......|:.||  |.|...:...::.:....:|...
  Fly   123 -FWMDNLFCEGHEQELVDCHFEGWGENDCEPGEAAGVVCYPPENALIPMATPIIRDEDLPKYPIH 186

  Fly  1199 EKAGLFDYTTNAFKPAVQMDHARHNLENVRIVNNLQDG---------------------LGIIYA 1242
            .::.|:          |::...|..:|. |:..:|..|                     ||:.||
  Fly   187 SRSRLY----------VRLRGGRSRIEG-RVEVSLDGGRWGSVCADGWSLLEANVVCRQLGLGYA 240

  Fly  1243 ------DIYAGKSVNN--IKNSEFSGNK 1262
                  |.:.|.:|:.  :..||..||:
  Fly   241 SEAFQTDFFGGFNVSRPVLSGSECYGNE 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
barkNP_001245864.1 SR 191..295 CDD:214555
SRCR 196..294 CDD:278931
CUB 459..552 CDD:238001
Beta_helix 579..752 CDD:289971
SR 1071..1175 CDD:214555 34/103 (33%)
SRCR 1076..1174 CDD:278931 30/97 (31%)
SR 1932..2037 CDD:214555
SRCR 1932..2037 CDD:278931
CLECT 2604..2699 CDD:214480
Loxl2NP_523806.2 SR 61..161 CDD:214555 34/103 (33%)
SRCR 66..160 CDD:278931 30/97 (31%)
SR 193..298 CDD:214555 17/77 (22%)
SRCR 198..298 CDD:278931 16/72 (22%)
Lysyl_oxidase 303..503 CDD:279521
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6743
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.